TkA01G430730 | RubberDandelionOmics

Gene overview

TkA01G430730

Reference: TK1151 Chr: Chr01 Coordinates: 107615127-107616363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · TkA01G430730|TK1151|cDNA

ATGCCAATGTGCCATGGAAGTTCAACCTCTGCATCTGACCTAAACCCCGAAATTATTAAACACCTCAGATCCAATCCAGCTAAAATGGGAAGAGGAGGAACCCTAAGCGAAGGTGTTATGAAGAAGATAATCATCTCATATAGTTACGTTGCCATATGGATCTTCCTCAGCTTCACTGTCATCGTCTACAACAAGTACATACTCGATCGCAATATGTACAACTGGCCTTACCCAATTTCACTCACCATGATTCACATGGG...

CDS

Download CDS FASTA

1131 bp · TkA01G430730|TK1151|CDS

ATGCCAATGTGCCATGGAAGTTCAACCTCTGCATCTGACCTAAACCCCGAAATTATTAAACACCTCAGATCCAATCCAGCTAAAATGGGAAGAGGAGGAACCCTAAGCGAAGGTGTTATGAAGAAGATAATCATCTCATATAGTTACGTTGCCATATGGATCTTCCTCAGCTTCACTGTCATCGTCTACAACAAGTACATACTCGATCGCAATATGTACAACTGGCCTTACCCAATTTCACTCACCATGATTCACATGGG...

Protein

Download Protein FASTA

376 aa · TkA01G430730|TK1151|PROTEIN

MPMCHGSSTSASDLNPEIIKHLRSNPAKMGRGGTLSEGVMKKIIISYSYVAIWIFLSFTVIVYNKYILDRNMYNWPYPISLTMIHMGFCSSLAYILVSVLKVVEPVQMTLNVYLKSVVPIGFLYSLSLWLSNSAYIYLSVSFIQMLKALMPVAVYSIGVLLKKEGFKGQTMSNMLSISFGVAIAAYGEAKYNSWGVTLQLGAVVFEATRLVLIQILLTSKGITFNPITSLYYVAPCCLIFLSVPWIIVELPKLRDTSSFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G430730`
TK1151 ID	TkA01G430730
OH-1004 ID	LXL04_028045
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.200
Protein coverage (%)	TK1151 92.287 / OH-1004 99.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G430730

Location Chr01:107615127-107616363 (+)

Description Similar to At2g25520: Probable sugar phosphate/phosphate translocator At2g25520

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25520`	Probable sugar phosphate/phosphate translocator At2g25520.	No verified direct reference in this release
`At5g25400`	Probable sugar phosphate/phosphate translocator At5g25400.	No verified direct reference in this release
`At4g32390`	Probable sugar phosphate/phosphate translocator At4g32390.	No verified direct reference in this release
`At5g11230`	Probable sugar phosphate/phosphate translocator At5g11230.	No verified direct reference in this release
`At1g48230`	Probable sugar phosphate/phosphate translocator At1g48230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005768 endosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G25520

ath:AT3G17430

ath:AT4G32390

ath:AT5G11230

ath:AT5G25400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.657

Rank 1 · TkA01G430730 · TK1151

Endoplasmic reticulum0.230

Rank 2 · TkA01G430730 · TK1151

Cytoplasm0.125

Rank 3 · TkA01G430730 · TK1151

Cell membrane0.051

Rank 4 · TkA01G430730 · TK1151

Lysosome / Vacuole0.039

Rank 5 · TkA01G430730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151TPT49-334 aa

PF00892EamA77-184 aa

PF11019DUF2608123-177 aa

PF00892EamA194-331 aa

PF11019DUF2608325-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G430730	`PF03151`	TPT	49	334	1.3e-21	78.0
TkA01G430730	`PF00892`	EamA	77	184	0.00049	21.1
TkA01G430730	`PF11019`	DUF2608	123	177	0.0098	16.1
TkA01G430730	`PF00892`	EamA	194	331	0.00049	21.1
TkA01G430730	`PF11019`	DUF2608	325	363	0.0098	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKJ7`	Arabidopsis thaliana	sp\|Q9SKJ7\|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520	84.300%	Swiss-Prot	High
`Q3E6T0`	Arabidopsis thaliana	sp\|Q3E6T0\|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400	83.700%	Swiss-Prot	High
`Q9SUV2`	Arabidopsis thaliana	sp\|Q9SUV2\|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390	81.400%	Swiss-Prot	High
`Q9LFN3`	Arabidopsis thaliana	sp\|Q9LFN3\|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230	82.000%	Swiss-Prot	High
`Q9LNH5`	Arabidopsis thaliana	sp\|Q9LNH5\|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230	46.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card