TkA01G428300 | RubberDandelionOmics

Gene overview

TkA01G428300

Reference: TK1151 Chr: Chr01 Coordinates: 106906573-106908120 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

978 bp · TkA01G428300|TK1151|cDNA

GAAATCCAATATCTTATCCTTTTGCTAGTTCTCTGGCTCTGTGTGAAGTCTCAATCCCACCCAAAAACACCAACACAAAACATAAAAACAAAAAAGAAAATAATAAGGAAGAAAAAAAAAGTGAAAATGGCAGGCATCTTTCTCTCCAATCCAAGCACCTTCCTCCCATCATCTTCATCATTTTCATCAGCGTCACACAAACAACCATCGAGAGGAACCAGTGTGTGTAAACCAGTGAGTAAATTACCAGATTGTCCTCC...

CDS

Download CDS FASTA

777 bp · TkA01G428300|TK1151|CDS

GAAATCCAATATCTTATCCTTTTGCTAGTTCTCTGGCTCTGTGTGAAGTCTCAATCCCACCCAAAAACACCAACACAAAACATAAAAACAAAAAAGAAAATAATAAGGAAGAAAAAAAAAGTGAAAATGGCAGGCATCTTTCTCTCCAATCCAAGCACCTTCCTCCCATCATCTTCATCATTTTCATCAGCGTCACACAAACAACCATCGAGAGGAACCAGTGTGTGTAAACCAGTGAGTAAATTACCAGATTGTCCTCC...

Protein

Download Protein FASTA

258 aa · TkA01G428300|TK1151|PROTEIN

EIQYLILLLVLWLCVKSQSHPKTPTQNIKTKKKIIRKKKKVKMAGIFLSNPSTFLPSSSSFSSASHKQPSRGTSVCKPVSKLPDCPPHMSKRSLSISLTSLFILSLSGNNNGANAAILEPDDDLELMEKIKKDRKKRIEKQTVLNSSSKDREYLQDVIYKLSKVGQAIENNDLASAGSVLGQTPDADWVKMANAALSQLSSSPEEISEVDAFNSSLTSLYSSVTKNDIEASKLAFVDSASAFEKWTTLTGLVGQLKGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G428300`
TK1151 ID	TkA01G428300
OH-1004 ID	LXL04_002694
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 97.287 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G428300

Location Chr01:106906573-106908120 (+)

Description Similar to At4g02530: Thylakoid lumenal 16.5 kDa protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02530`	Thylakoid lumenal 16.5 kDa protein, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010206 photosystem II repair Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0062068 chloroplast photosystem II binding Molecular Function

KEGG gene cross-reference

ath:AT4G02530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · TkA01G428300 · TK1151

Mitochondrion0.020

Rank 2 · TkA01G428300 · TK1151

Cytoplasm0.014

Rank 3 · TkA01G428300 · TK1151

Nucleus0.013

Rank 4 · TkA01G428300 · TK1151

Peroxisome0.011

Rank 5 · TkA01G428300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20675MPH2153-258 aa

PF30700ARM_GAC_1st189-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G428300	`PF20675`	MPH2	153	258	5.3e-44	150.1
TkA01G428300	`PF30700`	ARM_GAC_1st	189	244	0.0021	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22773`	Arabidopsis thaliana	sp\|O22773\|TL16_ARATH Thylakoid lumenal 16.5 kDa protein, chloroplastic	66.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card