TkA01G422540 | RubberDandelionOmics

Gene overview

TkA01G422540

Reference: TK1151 Chr: Chr01 Coordinates: 105531237-105532240 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA01G422540|TK1151|cDNA

ATGACAGCAAATCCAACTTTGATTGCATCTGGGGTGGTAACATCGGGTATGATGGGGAACACACAAGTTGCTGTAGGAGCTCAGGCTTCCTTTAACGCGTTAACAAGAAGCATCATCGACTACAATGTGGGAGTTAGCTATACCCAATCTGATCTTAATGCTGTGGTAACCATGTTGGACAAGGGCAAGACTGTAACCGCTTCTTACTACCACATCATCAAGCCCCTGACGAACACAATCGTGGGTGCAGAGGTAGCCTA...

CDS

Download CDS FASTA

480 bp · TkA01G422540|TK1151|CDS

ATGACAGCAAATCCAACTTTGATTGCATCTGGGGTGGTAACATCGGGTATGATGGGGAACACACAAGTTGCTGTAGGAGCTCAGGCTTCCTTTAACGCGTTAACAAGAAGCATCATCGACTACAATGTGGGAGTTAGCTATACCCAATCTGATCTTAATGCTGTGGTAACCATGTTGGACAAGGGCAAGACTGTAACCGCTTCTTACTACCACATCATCAAGCCCCTGACGAACACAATCGTGGGTGCAGAGGTAGCCTA...

Protein

Download Protein FASTA

159 aa · TkA01G422540|TK1151|PROTEIN

MTANPTLIASGVVTSGMMGNTQVAVGAQASFNALTRSIIDYNVGVSYTQSDLNAVVTMLDKGKTVTASYYHIIKPLTNTIVGAEVAYFFPSKENLFVFGIQHALDPLTTVKACVDTSGIVDALIQHQWGVNSLITISGTLDTRDIANRTQFGVGLSLKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G422540`
TK1151 ID	TkA01G422540
OH-1004 ID	LXL04_002769
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.600
Protein coverage (%)	TK1151 100.000 / OH-1004 70.982 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G422540

Location Chr01:105531237-105532240 (+)

Description Similar to VDAC1: Mitochondrial outer membrane protein porin 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01280`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	Molecular and genetic characterization of the gene family encoding the voltage-dependent anion channel in Arabidopsis.2011 · DOI: 10.1093/jxb/err113
`At5g15090`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0715500`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	No verified direct reference in this release
`Os03g0202200`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002769 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G01280

ath:AT5G15090

sot:102580103

sot:102603136

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.481

Rank 1 · TkA01G422540 · TK1151

Plastid0.387

Rank 2 · TkA01G422540 · TK1151

Cytoplasm0.073

Rank 3 · TkA01G422540 · TK1151

Extracellular0.030

Rank 4 · TkA01G422540 · TK1151

Nucleus0.026

Rank 5 · TkA01G422540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01459Porin_312-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G422540	`PF01459`	Porin_3	12	152	2.8e-31	109.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRH5`	Arabidopsis thaliana	sp\|Q9SRH5\|VDAC1_ARATH Mitochondrial outer membrane protein porin 1	46.500%	Swiss-Prot	Medium
`Q9SMX3`	Arabidopsis thaliana	sp\|Q9SMX3\|VDAC3_ARATH Mitochondrial outer membrane protein porin 3	42.100%	Swiss-Prot	Medium
`Q0JJV1`	Oryza sativa subsp. japonica	sp\|Q0JJV1\|VDAC4_ORYSJ Mitochondrial outer membrane protein porin 4	45.500%	Swiss-Prot	Medium
`Q84P97`	Oryza sativa subsp. japonica	sp\|Q84P97\|VDAC5_ORYSJ Mitochondrial outer membrane protein porin 5	34.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card