TkA01G422440 | RubberDandelionOmics

Gene overview

TkA01G422440

Reference: TK1151 Chr: Chr01 Coordinates: 105504585-105506806 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2116 bp · TkA01G422440|TK1151|cDNA

TTAGAAACCAATTAATTTTTTTATCTGTATAACGTGATTGATAAACAGCTTCCGGTTTATGTGATATTTCGAACAAAAACCTGGTTTTTGAATATTTCTTTCTCTAAAAAACACCATGGTTAATCACTTAATTGGAAATAAAGTCAAACTTCGTCAAAAGAAAAGTCAACCTTGAATTCTAAGGAACCTGCACAATCTTGAAACACACTCTTTGCTTTTCCCTCCCCTGTACCAGAAACTTGAAATCTTACCCACCATCC...

CDS

Download CDS FASTA

1509 bp · TkA01G422440|TK1151|CDS

ATGAAAGATCCAGAAACACTAACCCTAGATCCACCACCGCAACCACCGCCGGCCTTCTCCCTCTTCCCTACCCTCAATCCACCACATAAGACCCTAACTTTCCACAAAATCTCCACCCTTCTCATCACATTCATCGCCTACGCCGCCTTCCACGCTTCCCGGAAACCCCCCAGCATCGTCAAATCCGTCCTCGGCCCTGACCCCAATTCACCGCTAGACGGATGGCCGCCGTTCAACTCCGCCCGCGGCCCCCACCGTCT...

Protein

Download Protein FASTA

502 aa · TkA01G422440|TK1151|PROTEIN

MKDPETLTLDPPPQPPPAFSLFPTLNPPHKTLTFHKISTLLITFIAYAAFHASRKPPSIVKSVLGPDPNSPLDGWPPFNSARGPHRLGELDLAFLSAYAIGMYLSGHVGDRIDLRVFLTIGMIGSGVFTVLFGLGFWLDVHSLRYFIMIQICCGGFQSIGWPCVVAVMGNWFGKSKRGLIMGVWNSHTSVGNIIGSIIASSVLGFGWGWAFLLPGILIVLISIIVFLFLVVNPETIGLTLPSEEEEAEISNEGIALVTLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G422440`
TK1151 ID	TkA01G422440
OH-1004 ID	LXL04_002770
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G422440

Location Chr01:105504585-105506806 (+)

Description Similar to At2g13100: Putative glycerol-3-phosphate transporter 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g13100`	Putative glycerol-3-phosphate transporter 5.	No verified direct reference in this release
`At3g47420`	Putative glycerol-3-phosphate transporter 1.	No verified direct reference in this release
`At4g25220`	Putative glycerol-3-phosphate transporter 2.	No verified direct reference in this release
`At1g30560`	Putative glycerol-3-phosphate transporter 3.	No verified direct reference in this release
`At4g17550`	Putative glycerol-3-phosphate transporter 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002770 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055062 phosphate ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

GO:0061513 glucose 6-phosphate:phosphate antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G30560

ath:AT2G13100

ath:AT3G47420

ath:AT4G17550

ath:AT4G25220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.564

Rank 1 · TkA01G422440 · TK1151

Cell membrane0.158

Rank 2 · TkA01G422440 · TK1151

Endoplasmic reticulum0.156

Rank 3 · TkA01G422440 · TK1151

Cytoplasm0.129

Rank 4 · TkA01G422440 · TK1151

Golgi apparatus0.115

Rank 5 · TkA01G422440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_187-429 aa

PF03137OATP95-129 aa

PF00083Sugar_tr108-240 aa

PF03137OATP144-370 aa

PF00083Sugar_tr326-410 aa

PF07690MFS_1327-488 aa

PF03137OATP436-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G422440	`PF07690`	MFS_1	87	429	2.3e-48	165.6
TkA01G422440	`PF03137`	OATP	95	129	2.1	7.3
TkA01G422440	`PF00083`	Sugar_tr	108	240	0.0015	18.2
TkA01G422440	`PF03137`	OATP	144	370	2.1	7.3
TkA01G422440	`PF00083`	Sugar_tr	326	410	0.0015	18.2
TkA01G422440	`PF07690`	MFS_1	327	488	2.3e-48	165.6
TkA01G422440	`PF03137`	OATP	436	473	2.1	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL56`	Arabidopsis thaliana	sp\|Q9SL56\|GLPT5_ARATH Putative glycerol-3-phosphate transporter 5	70.100%	Swiss-Prot	High
`Q9C5L3`	Arabidopsis thaliana	sp\|Q9C5L3\|GLPT1_ARATH Putative glycerol-3-phosphate transporter 1	56.800%	Swiss-Prot	High
`Q9SB41`	Arabidopsis thaliana	sp\|Q9SB41\|GLPT2_ARATH Putative glycerol-3-phosphate transporter 2	55.400%	Swiss-Prot	High
`Q9SA71`	Arabidopsis thaliana	sp\|Q9SA71\|GLPT3_ARATH Putative glycerol-3-phosphate transporter 3	56.100%	Swiss-Prot	High
`O23596`	Arabidopsis thaliana	sp\|O23596\|GLPT4_ARATH Putative glycerol-3-phosphate transporter 4	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card