TkA01G421130 | RubberDandelionOmics

Gene overview

TkA01G421130

Reference: TK1151 Chr: Chr01 Coordinates: 105183961-105188907 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2393 bp · TkA01G421130|TK1151|cDNA

AAAATATTTAACATTTAAACTTTATATTTAACTTTCATATTTTACAATTCCTCCATAAGTTCCAAAACAAAATCTTTTATGACGCGATCCCTACATGTTCAAGAATCTGTGGCGACCTTTTATCTGTTAACTTAGTCCACTCTCCTCTCTCTCCCCCCGATCGTAAGAAAGCTGCTTTTCTTGGTCATCATCATGCTGAACTACCCTGCAACTTCTTCATTCAATTGCCAAAATACCCGATTCACACCACCTCCAGGTTA...

CDS

Download CDS FASTA

1818 bp · TkA01G421130|TK1151|CDS

ATGCTGAACTACCCTGCAACTTCTTCATTCAATTGCCAAAATACCCGATTCACACCACCTCCAGGTTACGCTCTCCACCCCTCATCTCTCACACTATCATCATCGTCGTCGTCGTCGTCGCCTTCATCATTGCACTCTTCTTCTCAATACCACCAAAACCTTCCTTCAGTCAATGCTTACAAGCACACCCGTTTCAATATCTCCCCACGAACAAAGGGACTGAAGGTGAGGTGCTCACAAAATGAGCCGTTGAAGGTTAT...

Protein

Download Protein FASTA

605 aa · TkA01G421130|TK1151|PROTEIN

MLNYPATSSFNCQNTRFTPPPGYALHPSSLTLSSSSSSSSPSSLHSSSQYHQNLPSVNAYKHTRFNISPRTKGLKVRCSQNEPLKVMISGAPASGKGTQCEMIVQKFGLVHISTGDLLRSEVAAGSEIGNQAKEFMNSGRLVPDELVTNMVIERLSRDDTKQKGWLLDGFPRSFPQAQSLEKMKIRPDVFIALDVPDETLIDRCVGRRLDPETGKIYHIKNFPPETEEIKARLITRPDDTEEKVKSRLQIYKQNVEAIVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G421130`
TK1151 ID	TkA01G421130
OH-1004 ID	LXL04_002779
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G421130

Location Chr01:105183961-105188907 (-)

Description Similar to At5g35170: Adenylate kinase 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35170`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`At5g47840`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0288200`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`Os08g0109300`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002779 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0097009 energy homeostasis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004017 AMP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G35170

ath:AT5G47840

dosa:Os08g0109300

dosa:Os08g0288200

osa:4345177

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · TkA01G421130 · TK1151

Mitochondrion0.038

Rank 2 · TkA01G421130 · TK1151

Cytoplasm0.029

Rank 3 · TkA01G421130 · TK1151

Peroxisome0.022

Rank 4 · TkA01G421130 · TK1151

Nucleus0.019

Rank 5 · TkA01G421130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06414Zeta_toxin78-114 aa

PF13238AAA_1886-208 aa

PF13671AAA_3386-124 aa

PF00406ADK88-264 aa

PF13207AAA_1790-208 aa

PF05191ADK_lid207-229 aa

PF09353DUF1995337-579 aa

PF13207AAA_17550-588 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G421130	`PF06414`	Zeta_toxin	78	114	0.072	13.2
TkA01G421130	`PF13238`	AAA_18	86	208	2.1e-05	25.7
TkA01G421130	`PF13671`	AAA_33	86	124	0.19	12.7
TkA01G421130	`PF00406`	ADK	88	264	6e-50	170.0
TkA01G421130	`PF13207`	AAA_17	90	208	2.8e-29	102.8
TkA01G421130	`PF05191`	ADK_lid	207	229	0.28	11.8
TkA01G421130	`PF09353`	DUF1995	337	579	1e-40	140.6
TkA01G421130	`PF13207`	AAA_17	550	588	2.8e-29	102.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYL1`	Arabidopsis thaliana	sp\|Q8VYL1\|KAD5_ARATH Adenylate kinase 5, chloroplastic	71.900%	Swiss-Prot	High
`Q9FIJ7`	Arabidopsis thaliana	sp\|Q9FIJ7\|KAD2_ARATH Adenylate kinase 2, chloroplastic	58.200%	Swiss-Prot	Low
`Q0J6P7`	Oryza sativa subsp. japonica	sp\|Q0J6P7\|KAD5_ORYSJ Probable adenylate kinase 5, chloroplastic	66.000%	Swiss-Prot	High
`Q6ZC69`	Oryza sativa subsp. japonica	sp\|Q6ZC69\|KAD2_ORYSJ Probable adenylate kinase 2, chloroplastic	59.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card