TkA01G420880 | RubberDandelionOmics

Gene overview

TkA01G420880

Reference: TK1151 Chr: Chr01 Coordinates: 105128808-105129319 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA01G420880|TK1151|cDNA

ATGTGTGAGTCGTTGAGTGTTGGAGTCCATACTTATCGTCATGTCATCAGACTTGTCACCATACTTGCTGCACAAGCTTTTGGCGCTCCAAGAATCGTGATTGTGGAAGTAGATGACAGCCGGTTGTCAGTTGCAAAACAACTTGGTGCAAATGAAATCATCAAAGTCTCGATTAATCTTCAAGTTCGCCTGGTAGGGATGGACTACCATGAGATGATTGTACCTCTTACTCCGGCAACCGTCGGGGAGGTCGATGTGGT...

CDS

Download CDS FASTA

348 bp · TkA01G420880|TK1151|CDS

ATGTGTGAGTCGTTGAGTGTTGGAGTCCATACTTATCGTCATGTCATCAGACTTGTCACCATACTTGCTGCACAAGCTTTTGGCGCTCCAAGAATCGTGATTGTGGAAGTAGATGACAGCCGGTTGTCAGTTGCAAAACAACTTGGTGCAAATGAAATCATCAAAGTCTCGATTAATCTTCAAGTTCGCCTGGTAGGGATGGACTACCATGAGATGATTGTACCTCTTACTCCGGCAACCGTCGGGGAGGTCGATGTGGT...

Protein

Download Protein FASTA

115 aa · TkA01G420880|TK1151|PROTEIN

MCESLSVGVHTYRHVIRLVTILAAQAFGAPRIVIVEVDDSRLSVAKQLGANEIIKVSINLQVRLVGMDYHEMIVPLTPATVGEVDVVGIFRYKNTWSLYLEFLRRGKIDGKPLIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G420880`
TK1151 ID	TkA01G420880
OH-1004 ID	LXL04_002788
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G420880

Location Chr01:105128808-105129319 (-)

Description Similar to VIT_16s0100g00290: L-idonate 5-dehydrogenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51970`	May catalyze NAD⁺-dependent oxidation of diverse sugar alcohols.	Sorbitol dehydrogenase is a cytosolic protein required for sorbitol metabolism in Arabidopsis thaliana.2013 · DOI: 10.1016/j.plantsci.2013.01.012

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002788 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006060 sorbitol metabolic process Biological Process

GO:0006062 sorbitol catabolic process Biological Process

GO:0030317 flagellated sperm motility Biological Process

GO:0046183 L-idonate catabolic process Biological Process

GO:0046370 fructose biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0031514 motile cilium Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

KEGG gene cross-reference

ath:AT5G51970

bta:508954

pon:100173784

vvi:100232980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.287

Rank 1 · TkA01G420880 · TK1151

Peroxisome0.202

Rank 2 · TkA01G420880 · TK1151

Extracellular0.178

Rank 3 · TkA01G420880 · TK1151

Mitochondrion0.135

Rank 4 · TkA01G420880 · TK1151

Nucleus0.131

Rank 5 · TkA01G420880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22371P7_N_core4-87 aa

PF00107ADH_zinc_N19-56 aa

PF00107ADH_zinc_N62-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G420880	`PF22371`	P7_N_core	4	87	0.11	13.2
TkA01G420880	`PF00107`	ADH_zinc_N	19	56	2.2e-10	41.3
TkA01G420880	`PF00107`	ADH_zinc_N	62	103	2.2e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ95`	Arabidopsis thaliana	sp\|Q9FJ95\|DHSO_ARATH Sorbitol dehydrogenase	45.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card