TkA01G419850 | RubberDandelionOmics

Gene overview

TkA01G419850

Reference: TK1151 Chr: Chr01 Coordinates: 104842724-104843656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA01G419850|TK1151|cDNA

CCCCCGACGGCTTCAAGCAATGGGCCAAAATCAAAACTCAACAAATTCAGCTCTAGAATCACCGAACCCAAGTCACAGGGTGGCTCTCAGGACGTACTTTACGGCGTAGGTCTCTCCGATGACGACCTTAAAAAACCCCAAATTGGTATTTCATCTGTTTGGTACGAAGGCAGTACCTGTAACATGCACTTACTAAAGCTAGCTGAGGCTGTGAAAGAAGGGGTTCAAGATGCTGGCTTGATTGGATTCAGGTTCAACAC...

CDS

Download CDS FASTA

525 bp · TkA01G419850|TK1151|CDS

CCCCCGACGGCTTCAAGCAATGGGCCAAAATCAAAACTCAACAAATTCAGCTCTAGAATCACCGAACCCAAGTCACAGGGTGGCTCTCAGGACGTACTTTACGGCGTAGGTCTCTCCGATGACGACCTTAAAAAACCCCAAATTGGTATTTCATCTGTTTGGTACGAAGGCAGTACCTGTAACATGCACTTACTAAAGCTAGCTGAGGCTGTGAAAGAAGGGGTTCAAGATGCTGGCTTGATTGGATTCAGGTTCAACAC...

Protein

Download Protein FASTA

174 aa · TkA01G419850|TK1151|PROTEIN

PPTASSNGPKSKLNKFSSRITEPKSQGGSQDVLYGVGLSDDDLKKPQIGISSVWYEGSTCNMHLLKLAEAVKEGVQDAGLIGFRFNTIGVSDAISMGTRGMCYSLHSRDLIADSIETVMSAQWYDANISIPGCDKNMPGTIMAMGRLNRPSIMIYGGTIKPGHFNGHTYDIVSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G419850`
TK1151 ID	TkA01G419850
OH-1004 ID	LXL04_004001
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.900
Protein coverage (%)	TK1151 98.851 / OH-1004 27.697 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G419850

Location Chr01:104842724-104843656 (+)

Description Similar to DHAD: Dihydroxy-acid dehydratase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23940`	Functions in the biosynthesis of branched-chain amino acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004001 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009082 branched-chain amino acid biosynthetic process Biological Process

GO:0009097 isoleucine biosynthetic process Biological Process

GO:0009099 L-valine biosynthetic process Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0048364 root development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004160 dihydroxy-acid dehydratase activity Molecular Function

KEGG gene cross-reference

ath:AT3G23940

fph:Fphi_1547

ftm:FTM_1218

ftw:FTW_1090

rba:RB12087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.503

Rank 1 · TkA01G419850 · TK1151

Cytoplasm0.218

Rank 2 · TkA01G419850 · TK1151

Peroxisome0.109

Rank 3 · TkA01G419850 · TK1151

Nucleus0.068

Rank 4 · TkA01G419850 · TK1151

Plastid0.049

Rank 5 · TkA01G419850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00920ILVD_EDD_N45-171 aa

PF29221Tudor_FlgD_C45-56 aa

PF29221Tudor_FlgD_C133-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G419850	`PF00920`	ILVD_EDD_N	45	171	1.3e-49	169.8
TkA01G419850	`PF29221`	Tudor_FlgD_C	45	56	0.1	13.3
TkA01G419850	`PF29221`	Tudor_FlgD_C	133	156	0.1	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIR4`	Arabidopsis thaliana	sp\|Q9LIR4\|ILVD_ARATH Dihydroxy-acid dehydratase, chloroplastic	88.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card