TkA01G419220 | RubberDandelionOmics

Gene overview

TkA01G419220

Reference: TK1151 Chr: Chr01 Coordinates: 104692978-104696246 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1816 bp · TkA01G419220|TK1151|cDNA

TAAAAGTTACTTGTCTCACGTGAATCAAACGTTAATTTGGATCCTGGGGGGATAAAAGAGGGGCCGAAATGACTTCTATCCATAAGGAGGCGAGAAGAGGGGTTTATGTGGTATCATTTAAAACCCCACTGAATCGATATTTTATGGTTCTCTTTTGAGCGCCCAACTCTCGTCACACTCTTCAAATCTCCGAAGGGTTTCGTAAAATCCACAAATTTTCTGCTTCCAATGGCTTGCAGACTCACAGATTCTAGTTTCCT...

CDS

Download CDS FASTA

1317 bp · TkA01G419220|TK1151|CDS

ATGGCTTGCAGACTCACAGATTCTAGTTTCCTTTTGAAGGGTCCCCAACAAAAGCGAATTCATGGTCATAGATTTGTGTCACTATATCCAACAGGCACATCTCTTTTGAAGTGGGAATCTCTACCTCAACACAAACCCAAAAACCAAAAATATATAATTCCTTTAAGAAGGGGTAAAATCGTAAAAGCAGTAGCCAGTCCTATCACACCACCATTCCCATTAGACAGTGCAGAAAGAAGACAAGAATTATGCGAAAGTTA...

Protein

Download Protein FASTA

438 aa · TkA01G419220|TK1151|PROTEIN

MACRLTDSSFLLKGPQQKRIHGHRFVSLYPTGTSLLKWESLPQHKPKNQKYIIPLRRGKIVKAVASPITPPFPLDSAERRQELCESYGFRQIGEPLPDNITLKNIIDSLPKSVFEIDNVKAWKSVLISLTSYALGLFMIAKSPWYLLPLAWAWTGTAITGVTIVRTNLSQRTNYWKTLLGLWHFLPLIYPYEPWRFKHDRHHAKTNMLKEDTAWHPVMKKHFEESPVFQKAIVFGYGPIRPIMSISHWIIWHFDLKKFRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G419220`
TK1151 ID	TkA01G419220
OH-1004 ID	LXL04_002810
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G419220

Location Chr01:104692978-104696246 (-)

Description Similar to Omega-6 fatty acid desaturase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30950`	Chloroplast omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes.	Identification of a gene that complements an Arabidopsis mutant deficient in chloroplast omega 6 desaturase activity.1994 · DOI: 10.1104/pp.106.4.1453

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002810 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0010205 photoinhibition Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

GO:0102850 acyl-lipid (n+3)-(Z)-desaturase (ferredoxin) activity Molecular Function

KEGG gene cross-reference

ath:AT4G30950

gmx:547807

syp:SYNPCC7002_A2756

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.918

Rank 1 · TkA01G419220 · TK1151

Mitochondrion0.041

Rank 2 · TkA01G419220 · TK1151

Endoplasmic reticulum0.039

Rank 3 · TkA01G419220 · TK1151

Golgi apparatus0.019

Rank 4 · TkA01G419220 · TK1151

Cell membrane0.015

Rank 5 · TkA01G419220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00487FA_desaturase120-158 aa

PF00487FA_desaturase170-386 aa

PF26819Phage_T4_Y16C371-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G419220	`PF00487`	FA_desaturase	120	158	1.1e-20	75.2
TkA01G419220	`PF00487`	FA_desaturase	170	386	1.1e-20	75.2
TkA01G419220	`PF26819`	Phage_T4_Y16C	371	405	0.017	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46312`	Arabidopsis thaliana	sp\|P46312\|FAD6C_ARATH Omega-6 fatty acid desaturase, chloroplastic	65.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card