TkA01G419200 | RubberDandelionOmics

Gene overview

TkA01G419200

Reference: TK1151 Chr: Chr01 Coordinates: 104677530-104682349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3107 bp · TkA01G419200|TK1151|cDNA

CCTAGAAACCGTGTTTTAGGCACACGTGTGTGCTCACACGCTTGGTCCGAAGTAGGGTTTAATAGACTGGGTTCCGCTTCGCAGCTCTTCCTCTTTCTCCCACACCACAACCCCTCGTCCCCTTTTCTTTTGTTCGATCCCCAAGCAAATACCCAAATCAATCGATCCATTTATGTTCCTAGAAACACAGCAATCTCCAGTGTTTCAACTACACCTTTGAATTGATTTAAATCTATCATGGCCGACACTTTGAGTTGGGC...

CDS

Download CDS FASTA

2601 bp · TkA01G419200|TK1151|CDS

ATGGCCGACACTTTGAGTTGGGCTGATAATAATATTATCGTCACTCAAAAACCCATTAATCGTGAAAACCCAGGTGGTGAATTGACTGAATCTTTAGCTCCGGCGGATAAATCTCCGTTTAGAAGGATTGAGTTTCACGTAGCCAGAAAGCCGTTCACTGGGTTTACTAAAGGAGGCGGCGATGGGAGTTTTCGGCTTGAAACGCTCAATCCTACCTCGACGAGCTCGAATAATACGAATGGAAATCAGCAGAACGTCGG...

Protein

Download Protein FASTA

866 aa · TkA01G419200|TK1151|PROTEIN

MADTLSWADNNIIVTQKPINRENPGGELTESLAPADKSPFRRIEFHVARKPFTGFTKGGGDGSFRLETLNPTSTSSNNTNGNQQNVGLDSVGGGSSGKKRDASELGNGLDPELSFGITFKRIGAGLENLGNTCFLNSVLQCLTYTEPLAAYLQSGKHQVSCRKAGFCALCAIQKHVSRALQATGRSVAPKDLVSNLRCISRTFRNSRQEDAHEYMVNLLESMHKCCLPTGVPSESQNAYEKSLVHKIFGGRLRSQVKCMQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G419200`
TK1151 ID	TkA01G419200
OH-1004 ID	LXL04_002811
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G419200

Location Chr01:104677530-104682349 (-)

Description Similar to UBP23: Ubiquitin carboxyl-terminal hydrolase 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57990`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002811 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006508 proteolysis Biological Process

GO:0007000 nucleolus organization Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0016242 negative regulation of macroautophagy Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0050821 protein stabilization Biological Process

GO:1901524 regulation of mitophagy Biological Process

GO:1903955 positive regulation of protein targeting to mitochondrion Biological Process

GO:2000232 regulation of rRNA processing Biological Process

KEGG gene cross-reference

ath:AT5G57990

hsa:57602

hsa:84132

mmu:72344

rno:288482

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA01G419200 · TK1151

Cytoplasm0.101

Rank 2 · TkA01G419200 · TK1151

Cell membrane0.026

Rank 3 · TkA01G419200 · TK1151

Mitochondrion0.017

Rank 4 · TkA01G419200 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA01G419200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443UCH124-425 aa

PF13423UCH_1124-406 aa

PF24042DUF7351142-198 aa

PF24042DUF7351231-334 aa

PF16278zf-C2HE252-268 aa

PF16278zf-C2HE302-322 aa

PF02259FAT591-693 aa

PF13423UCH_1597-668 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G419200	`PF00443`	UCH	124	425	3e-64	217.8
TkA01G419200	`PF13423`	UCH_1	124	406	4.2e-22	79.9
TkA01G419200	`PF24042`	DUF7351	142	198	0.47	10.9
TkA01G419200	`PF24042`	DUF7351	231	334	0.47	10.9
TkA01G419200	`PF16278`	zf-C2HE	252	268	0.31	12.2
TkA01G419200	`PF16278`	zf-C2HE	302	322	0.31	12.2
TkA01G419200	`PF02259`	FAT	591	693	0.15	12.0
TkA01G419200	`PF13423`	UCH_1	597	668	4.2e-22	79.9
TkA01G419200	`PF00443`	UCH	670	670	3e-64	217.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPS4`	Arabidopsis thaliana	sp\|Q9FPS4\|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23	43.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card