TkA01G418490 | RubberDandelionOmics

Gene overview

TkA01G418490

Reference: TK1151 Chr: Chr01 Coordinates: 104499684-104507419 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1770 bp · TkA01G418490|TK1151|cDNA

ATATGATACTTGACTCTTTTCTTTTCTGCATATAACCTAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGACTGTTGAGAGAGAGAGAGAGATGGGGGGTCAAAGGAGAAAGATAACTGATCAGACGTGTCTAGTTGTTATGTGGTTTATCTTCAGTTCAAGATTCACCGACACAGCTTCATCACCAACCACACAACAAGAAAAAGATCTAATCACAGCGTTGCCGGGGCAGCCGG...

CDS

Download CDS FASTA

1401 bp · TkA01G418490|TK1151|CDS

ATGGGGGGTCAAAGGAGAAAGATAACTGATCAGACGTGTCTAGTTGTTATGTGGTTTATCTTCAGTTCAAGATTCACCGACACAGCTTCATCACCAACCACACAACAAGAAAAAGATCTAATCACAGCGTTGCCGGGGCAGCCGGAGGTGGCGTTCTCTCAGTTTTCCGGCTACGTTACCGTCCACAAGAAAAATGGTCGAGCTCTTTTCTACTGGTTAACTGAAGCTGCAGCTCAGAATCCACAGCAAAAACCTCTTGT...

Protein

Download Protein FASTA

466 aa · TkA01G418490|TK1151|PROTEIN

MGGQRRKITDQTCLVVMWFIFSSRFTDTASSPTTQQEKDLITALPGQPEVAFSQFSGYVTVHKKNGRALFYWLTEAAAQNPQQKPLVLWLNGGPGCSSIAYGASEEIGPFRINKTLSLYLNKYSWNKEANILFLESPAGVGFSYTNTSSDLKDSGDKRTARDALIFLKRWMSRFPQYKQREFYISGESYAGHYIPQLAKKIHNYNQNHPNSFINLKGFIVGNAVTDNKYDNIGTVEYWWSHSIISDATHNLIRSSCTFSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G418490`
TK1151 ID	TkA01G418490
OH-1004 ID	LXL04_002824
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G418490

Location Chr01:104499684-104507419 (-)

Description Similar to SCPL24: Serine carboxypeptidase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30610`	Active serine carboxypeptidase with broad substrate preference, including basic and hydrophilic groups.	BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.091065998 Arabidopsis BRS1 is a secreted and active serine carboxypeptidase.2005 · DOI: 10.1074/jbc.m503299200
`At2g24000`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g24010`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g02110`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g35780`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002824 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24000

ath:AT2G24010

ath:AT2G35780

ath:AT3G02110

ath:AT4G30610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.414

Rank 1 · TkA01G418490 · TK1151

Extracellular0.331

Rank 2 · TkA01G418490 · TK1151

Cytoplasm0.100

Rank 3 · TkA01G418490 · TK1151

Cell membrane0.090

Rank 4 · TkA01G418490 · TK1151

Endoplasmic reticulum0.086

Rank 5 · TkA01G418490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1045-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G418490	`PF00450`	Peptidase_S10	45	459	1.1e-143	480.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M099`	Arabidopsis thaliana	sp\|Q9M099\|SCP24_ARATH Serine carboxypeptidase 24	69.800%	Swiss-Prot	High
`Q1PF08`	Arabidopsis thaliana	sp\|Q1PF08\|SCP22_ARATH Serine carboxypeptidase-like 22	62.900%	Swiss-Prot	High
`O82229`	Arabidopsis thaliana	sp\|O82229\|SCP23_ARATH Putative serine carboxypeptidase-like 23	65.100%	Swiss-Prot	High
`Q8L9Y0`	Arabidopsis thaliana	sp\|Q8L9Y0\|SCP25_ARATH Serine carboxypeptidase-like 25	61.800%	Swiss-Prot	High
`Q9ZQQ0`	Arabidopsis thaliana	sp\|Q9ZQQ0\|SCP26_ARATH Serine carboxypeptidase-like 26	57.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card