TkA01G417930 | RubberDandelionOmics

Gene overview

TkA01G417930

Reference: TK1151 Chr: Chr01 Coordinates: 104355561-104358524 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1336 bp · TkA01G417930|TK1151|cDNA

TGAAAATGTAGGGCTTTTATGCCATTTGCCCTAAGAAAATCATGTAAGAATTTTGCTATTACAAATTTAAAATCGCTTACAAGGCACGGATTTTCAATTGAAGATTAGTCGTTGTATAACTGCAAAGCTCCCGCGCATCTACTGCAAGCGAGAGAGGGGGGAATGGCGTCGAAAACCAACGCCGGTTCAGACGAATCGTTAAAGCTCGCCTTAGCCATGACTCTTCTTCGTTCTAAATTCCTGAAGAAACCTTCTGAAAC...

CDS

Download CDS FASTA

432 bp · TkA01G417930|TK1151|CDS

ATGTCACTGCGCTTAGTTAGAAAAATGTGTCCTACATCACAAGGAACTGAAGCTCATCAGTTTCAAACTGATGCCCAATTCCATGTTCAGCATTTGCTTCGTAAGCTTGGAAGTGAATCATGTATTGGACAAAGAGTGATTCTTTCAGTTTGTCAAAGAATCTCATTACTGGCTGAAACTTTGCTATTTCTTGATCCATTTGATTCAGCTTTTCTGAAATGCATAGCAGTCTATATTATGATCCAGCTTATTGAGTTTTT...

Protein

Download Protein FASTA

143 aa · TkA01G417930|TK1151|PROTEIN

MSLRLVRKMCPTSQGTEAHQFQTDAQFHVQHLLRKLGSESCIGQRVILSVCQRISLLAETLLFLDPFDSAFLKCIAVYIMIQLIEFLVSDYLISWSKTDGFASELLEEWVTSVLHARKGLQLLESRCGLYVLYMDRVIGLTAK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417930`
TK1151 ID	TkA01G417930
OH-1004 ID	LXL04_002832
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 37.403 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G417930

Location Chr01:104355561-104358524 (+)

Description Similar to MPS1: Protein MULTIPOLAR SPINDLE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57880`	Involved in meiotic spindle organization in meiocytes thus regulating chromosome segregation.	A high throughput genetic screen identifies new early meiotic recombination functions in Arabidopsis thaliana.2009 · DOI: 10.1371/journal.pgen.1000654

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002832 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000212 meiotic spindle organization Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0042138 meiotic DNA double-strand break formation Biological Process

GO:0048236 plant-type sporogenesis Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005819 spindle Cellular Component

KEGG gene cross-reference

ath:AT5G57880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.449

Rank 1 · TkA01G417930 · TK1151

Nucleus0.391

Rank 2 · TkA01G417930 · TK1151

Mitochondrion0.177

Rank 3 · TkA01G417930 · TK1151

Cell membrane0.079

Rank 4 · TkA01G417930 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA01G417930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30991MPS13-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417930	`PF30991`	MPS1	3	143	6.4e-62	210.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KDF5`	Arabidopsis thaliana	sp\|F4KDF5\|MUPS1_ARATH Protein MULTIPOLAR SPINDLE 1	52.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card