TkA01G417910 | RubberDandelionOmics

Gene overview

TkA01G417910

Reference: TK1151 Chr: Chr01 Coordinates: 104350069-104353601 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1891 bp · TkA01G417910|TK1151|cDNA

AAAATCCAAGTATAAAATAGTTGAAATCCTTGATGCGCAGTATCGCACCACCAAGTTAAAGGGTTTTCTCTCTCTCCTCTTTTTCTTTTCTCTCGCTTCCTCCAGGAGAGAGAAAGTTCCTTCCCTAATCTCTCTTTTCTCCATCTATCCCTACAGAAAACCCTATCTTTCGTAGTCGTCAAGATTTTGTTTAAATCTTGATTCTACTGACTTGAGCTTTGTTCGTCAATCGTTGATTGAACTTTTCCGTTTTTGTTCGA...

CDS

Download CDS FASTA

1602 bp · TkA01G417910|TK1151|CDS

ATGCAGGCTGATCAGACATCGTTGAGCTTGAGACCTGGTGGTGGAAATCGAGGAAGAACTTCTGGCCCTCGTTTTGATTCGTTGGCCTTCGGTTCATCTGATCTTCCAGCCCTTCGACCTCATGGCGGTTCTGGCGCTTCCTCTCTTGCCGCCTTCAAGGACAATGATTCCCGATTTGAGCTTCGTGAACGTGTTCGTTACACCAGAGACCAGCTGTTACAACTCAGAGAGGTTGTAGATATACCAGAAGAGATACTAAA...

Protein

Download Protein FASTA

533 aa · TkA01G417910|TK1151|PROTEIN

MQADQTSLSLRPGGGNRGRTSGPRFDSLAFGSSDLPALRPHGGSGASSLAAFKDNDSRFELRERVRYTRDQLLQLREVVDIPEEILKVKQEVDTEFFGEAQNWTKTEGNAAVPAQARYSEPDNRDWRGRAPPSVEERSWDSGRDNNNNNNRDFCGNQYNNRQDPNSQEQIGGPAPALVKAEVPWSVRRGTLSDKDRVLKTIKGILNKLTPEKFDLLKGQLIDSGITTADILKGVISLIFDKAVLEPTFCPMYAQLCSDLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417910`
TK1151 ID	TkA01G417910
OH-1004 ID	LXL04_002833
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.900
Protein coverage (%)	TK1151 99.812 / OH-1004 72.436 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G417910

Location Chr01:104350069-104353601 (+)

Description Similar to EIF(ISO)4G1: Eukaryotic translation initiation factor isoform 4G-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57870`	Plays a role in the accumulation of some potyvirus during viral infection.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0611500`	Plays a role in the accumulation of a sobemovirus (RYMV) during viral infection.	No verified direct reference in this release
`Os04g0499300`	Plays a role in the accumulation of a sobemovirus (RYMV) during viral infection.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002833 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006413 translational initiation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009536 plastid Cellular Component

GO:0016281 eukaryotic translation initiation factor 4F complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

KEGG gene cross-reference

ath:AT5G57870

dosa:Os02g0611500

dosa:Os04g0499300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.705

Rank 1 · TkA01G417910 · TK1151

Nucleus0.274

Rank 2 · TkA01G417910 · TK1151

Cell membrane0.142

Rank 3 · TkA01G417910 · TK1151

Golgi apparatus0.090

Rank 4 · TkA01G417910 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA01G417910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21140eIF4G1-like_eIF4E-bd66-78 aa

PF02854MIF4G199-423 aa

PF21140eIF4G1-like_eIF4E-bd313-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417910	`PF21140`	eIF4G1-like_eIF4E-bd	66	78	0.36	11.6
TkA01G417910	`PF02854`	MIF4G	199	423	1.4e-55	188.9
TkA01G417910	`PF21140`	eIF4G1-like_eIF4E-bd	313	323	0.36	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZT6`	Arabidopsis thaliana	sp\|Q93ZT6\|IF4G1_ARATH Eukaryotic translation initiation factor isoform 4G-1	61.900%	Swiss-Prot	High
`Q6K641`	Oryza sativa subsp. japonica	sp\|Q6K641\|IF4G2_ORYSJ Eukaryotic translation initiation factor isoform 4G-2	63.300%	Swiss-Prot	High
`Q84PB3`	Oryza sativa subsp. japonica	sp\|Q84PB3\|IF4G1_ORYSJ Eukaryotic translation initiation factor isoform 4G-1	64.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card