TkA01G417770 | RubberDandelionOmics

Gene overview

TkA01G417770

Reference: TK1151 Chr: Chr01 Coordinates: 104301625-104303574 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1500 bp · TkA01G417770|TK1151|cDNA

ATGGCTACGAAGGCAGATAAAGCAATCGGAATAGACCTTGGTACAACTTATAGTTGTGTCGGGGTATGGCAGAACGACCGCGTGGAGATCATTCCAAACGATCAAGATGCTAAACGTTTGATTGGGCGGCGCTTCACTGACCCTTCTGTTCAGAGCGACATGAAGTTGTGGCCGTTTAAAGTTATCTCCGGCCCTGGTGAGAAACCGATGATCGTTGTTAACTACAAAGGAGAAGAAAAGCAATTTGCTCCGGAGGAGAT...

CDS

Download CDS FASTA

1500 bp · TkA01G417770|TK1151|CDS

ATGGCTACGAAGGCAGATAAAGCAATCGGAATAGACCTTGGTACAACTTATAGTTGTGTCGGGGTATGGCAGAACGACCGCGTGGAGATCATTCCAAACGATCAAGATGCTAAACGTTTGATTGGGCGGCGCTTCACTGACCCTTCTGTTCAGAGCGACATGAAGTTGTGGCCGTTTAAAGTTATCTCCGGCCCTGGTGAGAAACCGATGATCGTTGTTAACTACAAAGGAGAAGAAAAGCAATTTGCTCCGGAGGAGAT...

Protein

Download Protein FASTA

499 aa · TkA01G417770|TK1151|PROTEIN

MATKADKAIGIDLGTTYSCVGVWQNDRVEIIPNDQDAKRLIGRRFTDPSVQSDMKLWPFKVISGPGEKPMIVVNYKGEEKQFAPEEISSMVLVKMKETAEAFLGQTIKNAVVTVPAYFNDSQRQATKDAEFRRKHKKDISGNARALRRLRTACERAKRELCMDMFRKCMDPVEKCLKDAKIDKGSVHEVVLVGGSTRIPKVQQLLIDFFNGKELCKSINPDEAVAYGAAVQAAILTGEGDEKVQDLLLLDVTPLSLGLET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417770`
TK1151 ID	TkA01G417770
OH-1004 ID	LXL04_002835
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.900
Protein coverage (%)	TK1151 100.000 / OH-1004 96.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G417770

Location Chr01:104301625-104303574 (+)

Description Similar to HSP70: Heat shock 70 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16030`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At3g12580`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).	Comprehensive expression profile analysis of the Arabidopsis Hsp70 gene family.2001 · DOI: 10.1104/pp.126.2.789 Heat shock protein cognate 70-4 and an E3 ubiquitin ligase, CHIP, mediate plastid-destined precursor degradation through the ubiquitin-26S proteasome system in Arabidopsis.2009 · DOI: 10.1105/tpc.109.071548

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002835 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009408 response to heat Biological Process

GO:0009615 response to virus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042026 protein refolding Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G16030

ath:AT3G12580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · TkA01G417770 · TK1151

Nucleus0.296

Rank 2 · TkA01G417770 · TK1151

Cell membrane0.121

Rank 3 · TkA01G417770 · TK1151

Mitochondrion0.115

Rank 4 · TkA01G417770 · TK1151

Endoplasmic reticulum0.112

Rank 5 · TkA01G417770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP708-36 aa

PF00012HSP7036-129 aa

PF13476AAA_2376-158 aa

PF25055DUF7792113-179 aa

PF00012HSP70130-160 aa

PF00012HSP70159-467 aa

PF02782FGGY_C165-234 aa

PF13476AAA_23334-454 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417770	`PF00012`	HSP70	8	36	1.1e-158	529.9
TkA01G417770	`PF00012`	HSP70	36	129	1.1e-158	529.9
TkA01G417770	`PF13476`	AAA_23	76	158	0.33	12.3
TkA01G417770	`PF25055`	DUF7792	113	179	0.062	14.1
TkA01G417770	`PF00012`	HSP70	130	160	1.1e-158	529.9
TkA01G417770	`PF00012`	HSP70	159	467	1.1e-158	529.9
TkA01G417770	`PF02782`	FGGY_C	165	234	0.0015	19.2
TkA01G417770	`PF13476`	AAA_23	334	454	0.33	12.3
TkA01G417770	`PF06098`	Radial_spoke_3	365	465	0.015	15.4
TkA01G417770	`PF25055`	DUF7792	367	393	0.062	14.1
TkA01G417770	`PF21408`	MTR4-like_stalk	368	408	2.7	9.0
TkA01G417770	`PF21408`	MTR4-like_stalk	442	455	2.7	9.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9N1`	Arabidopsis thaliana	sp\|Q9S9N1\|HSP7E_ARATH Heat shock 70 kDa protein 5	64.300%	Swiss-Prot	High
`Q9LHA8`	Arabidopsis thaliana	sp\|Q9LHA8\|HS704_ARATH Heat shock 70 kDa protein 4	64.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card