TkA01G417740 | RubberDandelionOmics

Gene overview

TkA01G417740

Reference: TK1151 Chr: Chr01 Coordinates: 104291945-104295822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2563 bp · TkA01G417740|TK1151|cDNA

TCAATACGGTATAACCGTTAGACTATATACTACTCCATAATTTAAAAAATAGTTAGAAGGACTGAAATGTAAATATGCTAAATCTAGGGGTTCCTTTGTAATGACAGTTTAACAAAAAAACAAACCTCCGTCATAAACCCCTCCTTATCAGTTATCCCCTCTATTTCTCCCTCTAGCCTTTTCCAATCCAGCGATGTTCTCTGCTTCCCCCAAGCTACTCTGCTCTCAAAGTTTTTCTTTCACAAAATGTCCTAATTCAC...

CDS

Download CDS FASTA

2106 bp · TkA01G417740|TK1151|CDS

ATGTTCTCTGCTTCCCCCAAGCTACTCTGCTCTCAAAGTTTTTCTTTCACAAAATGTCCTAATTCACAGCTCCAATTTTCACCCAAAATTCGTTTACTTTATTCTCACAAACCCCTAATTCGATGTGCTAGAAGAGGGGCCAAACGAACAGGTAAGTCGAGGTACCCATCAGAGAAAAGAAAGCTAAAATCAATCCAACAAACTCAAACCGAAATCGACAAGTTCAAAGGGTTTTGGAGGCTTTTCAAACTTGGTGTTCC...

Protein

Download Protein FASTA

701 aa · TkA01G417740|TK1151|PROTEIN

MFSASPKLLCSQSFSFTKCPNSQLQFSPKIRLLYSHKPLIRCARRGAKRTGKSRYPSEKRKLKSIQQTQTEIDKFKGFWRLFKLGVPIDRDPGKDFLDISDALLQEVAKVLEFPVASMLPPEAFTVLRKSFDARKSQKEPKFVYTVEMDVDKLLNLEPRTWDFISRLEPKIGLIEHTPHEKIVGDLVNVIQDKKKTDQYTLPDQNGHSGSPNSLNIRSTKKSKVAIVGSGPAGLFACLVLAEFGVDVTLIERGQAVEKRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417740`
TK1151 ID	TkA01G417740
OH-1004 ID	LXL04_002836
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G417740`
Location	Chr01:104291945-104295822 (-)
Description	Similar to Cbei_0202: Uncharacterized protein Cbei_0202 (Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002836` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016491 oxidoreductase activity Molecular Function
KEGG gene cross-reference	cbe:Cbei_0202 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.835

Rank 1 · TkA01G417740 · TK1151

Mitochondrion0.205

Rank 2 · TkA01G417740 · TK1151

Cytoplasm0.049

Rank 3 · TkA01G417740 · TK1151

Nucleus0.038

Rank 4 · TkA01G417740 · TK1151

Peroxisome0.019

Rank 5 · TkA01G417740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28550DUF8436101-147 aa

PF05834Lycopene_cycl132-154 aa

PF01262AlaDh_PNT_C216-275 aa

PF01946Thi4221-255 aa

PF07992Pyr_redox_2222-256 aa

PF01494FAD_binding_3222-258 aa

PF01266DAO223-255 aa

PF07992Pyr_redox_2223-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417740	`PF28550`	DUF8436	101	147	0.00021	22.2
TkA01G417740	`PF05834`	Lycopene_cycl	132	154	0.54	10.0
TkA01G417740	`PF01262`	AlaDh_PNT_C	216	275	0.0086	16.2
TkA01G417740	`PF01946`	Thi4	221	255	0.0024	17.9
TkA01G417740	`PF07992`	Pyr_redox_2	222	256	1.3e-10	42.0
TkA01G417740	`PF01494`	FAD_binding_3	222	258	6.1e-08	33.0
TkA01G417740	`PF01266`	DAO	223	255	2.1e-11	44.7
TkA01G417740	`PF07992`	Pyr_redox_2	223	254	1.3e-10	42.0
TkA01G417740	`PF00070`	Pyr_redox	223	278	6.3e-08	33.7
TkA01G417740	`PF03486`	HI0933_like	223	258	8.9e-08	32.6
TkA01G417740	`PF01134`	GIDA	223	257	0.00034	20.5
TkA01G417740	`PF03721`	UDPG_MGDP_dh_N	223	251	0.21	12.0
TkA01G417740	`PF00890`	FAD_binding_2	224	255	1.2e-09	38.6
TkA01G417740	`PF12831`	FAD_oxidored	224	254	0.0037	17.3
TkA01G417740	`PF02558`	ApbA	224	262	0.05	13.9
TkA01G417740	`PF05834`	Lycopene_cycl	224	256	0.54	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card