TkA01G417730 | RubberDandelionOmics

Gene overview

TkA01G417730

Reference: TK1151 Chr: Chr01 Coordinates: 104286764-104288526 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · TkA01G417730|TK1151|cDNA

ATGTTGCCAAATTTGAAGACCAGAGAAGTTAGTTCTAGGTACAAATCACCTACACCAATAAGGCGTTGTCCTTCTCCTTCCCCAAACACAACAAGAACAGCTACAACCACAACACCAAACAGAGCTATATCTGCAGAAAGACGGCGACTTGGAACACCAAAATTACCATCATACCCCTCCACCCCACTGCGTGTTTCATTCCAGTCTGATACCTTTTCGATTCCCACTAGCAAGAGAGAAAAACCGCCCCCTCAAGCTCT...

CDS

Download CDS FASTA

1320 bp · TkA01G417730|TK1151|CDS

ATGTTGCCAAATTTGAAGACCAGAGAAGTTAGTTCTAGGTACAAATCACCTACACCAATAAGGCGTTGTCCTTCTCCTTCCCCAAACACAACAAGAACAGCTACAACCACAACACCAAACAGAGCTATATCTGCAGAAAGACGGCGACTTGGAACACCAAAATTACCATCATACCCCTCCACCCCACTGCGTGTTTCATTCCAGTCTGATACCTTTTCGATTCCCACTAGCAAGAGAGAAAAACCGCCCCCTCAAGCTCT...

Protein

Download Protein FASTA

439 aa · TkA01G417730|TK1151|PROTEIN

MLPNLKTREVSSRYKSPTPIRRCPSPSPNTTRTATTTTPNRAISAERRRLGTPKLPSYPSTPLRVSFQSDTFSIPTSKREKPPPQALSDRTSNVSQKPSRKSTPERKRSPLKGKNAIDHSENSKPLEGLHSSKVIDQHRWPSRTSSKVLEKSTSDPVRVLSSIPNKGRLDYDNLKRMSNLVSSRSQSFPVTPNYKPSVLASKNVSPSRRPGSPLRQPCNSNKVSVLTFISDIKKGKRVVDQIEDAHYLRLLYNRQVQWRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417730`
TK1151 ID	TkA01G417730
OH-1004 ID	LXL04_002837
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G417730

Location Chr01:104286764-104288526 (-)

Description Similar to QWRF4: QWRF motif-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30710`	Contributes to the assembly of the acentrosomal spindle and phragmoplast microtubule arrays as part of the augmin complex.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610
`At2g24070`	QWRF motif-containing protein 4.	No verified direct reference in this release
`At1g49890`	QWRF motif-containing protein 2.	No verified direct reference in this release
`At3g19570`	Probable microtubule-associated peroxisomal protein required for chloroplast biogenesis and for the formation of the prolamellar body and prothylakoids in etioplasts.	No verified direct reference in this release
`At5g43160`	QWRF motif-containing protein 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002837 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005880 nuclear microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT2G24070

ath:AT3G19570

ath:AT4G30710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.648

Rank 1 · TkA01G417730 · TK1151

Nucleus0.334

Rank 2 · TkA01G417730 · TK1151

Cell membrane0.119

Rank 3 · TkA01G417730 · TK1151

Plastid0.045

Rank 4 · TkA01G417730 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA01G417730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04484QWRF89-410 aa

PF04859DUF641236-318 aa

PF24393Pepco264-314 aa

PF24393Pepco344-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417730	`PF04484`	QWRF	89	410	2.1e-72	245.1
TkA01G417730	`PF04859`	DUF641	236	318	0.24	12.5
TkA01G417730	`PF24393`	Pepco	264	314	0.22	12.7
TkA01G417730	`PF24393`	Pepco	344	387	0.22	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUH5`	Arabidopsis thaliana	sp\|Q9SUH5\|AUG8_ARATH AUGMIN subunit 8	35.400%	Swiss-Prot	Medium
`F4INP9`	Arabidopsis thaliana	sp\|F4INP9\|QWRF4_ARATH QWRF motif-containing protein 4	40.100%	Swiss-Prot	Medium
`Q94AI1`	Arabidopsis thaliana	sp\|Q94AI1\|QWRF2_ARATH QWRF motif-containing protein 2	45.200%	Swiss-Prot	Low
`Q8GXD9`	Arabidopsis thaliana	sp\|Q8GXD9\|SCO3_ARATH Protein SNOWY COTYLEDON 3	46.000%	Swiss-Prot	Low
`F4K4M0`	Arabidopsis thaliana	sp\|F4K4M0\|QWRF9_ARATH QWRF motif-containing protein 9	44.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card