TkA01G416590 | RubberDandelionOmics

Gene overview

TkA01G416590

Reference: TK1151 Chr: Chr01 Coordinates: 103954404-103957617 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1926 bp · TkA01G416590|TK1151|cDNA

ATGGCGTCGTCCCCTACGTACTCGCATATAAATACATGGAGATTGTCAATCAGATTCTGGTCACACCGGCTCTTGGCTCCTTGTTTTCGGAGGAATCCTTACACAGACTGTCTCTCCATCAAATTTAGGTTTACTTTGATCACGGTTCAGCTAATGTGGGAAGAGAAGAAGAGGACTAATGCATGGCAATGGCCAGAGCAGGAACCCACAGAATTTTCCGGGGAAAAGCGTGCATTAATGGAGCTGAAAGAGAATAAAGA...

CDS

Download CDS FASTA

1926 bp · TkA01G416590|TK1151|CDS

ATGGCGTCGTCCCCTACGTACTCGCATATAAATACATGGAGATTGTCAATCAGATTCTGGTCACACCGGCTCTTGGCTCCTTGTTTTCGGAGGAATCCTTACACAGACTGTCTCTCCATCAAATTTAGGTTTACTTTGATCACGGTTCAGCTAATGTGGGAAGAGAAGAAGAGGACTAATGCATGGCAATGGCCAGAGCAGGAACCCACAGAATTTTCCGGGGAAAAGCGTGCATTAATGGAGCTGAAAGAGAATAAAGA...

Protein

Download Protein FASTA

641 aa · TkA01G416590|TK1151|PROTEIN

MASSPTYSHINTWRLSIRFWSHRLLAPCFRRNPYTDCLSIKFRFTLITVQLMWEEKKRTNAWQWPEQEPTEFSGEKRALMELKENKEDELPLPKRPKPSSLTTNEWHSEYNRLKGPGPLGSKLDHSAFIEQHQKTRNQAHKNGGSSPPKNLQMEKKKDVKATFGTSDKIEKLKASNFPAMHLKIGRWEYTSQHEGHLVAKCYYAKHKLVWEVLDGGLKNKIEIKWEDIVGLQANFPENGNAILAVTVGKEPLYFRETNPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G416590`
TK1151 ID	TkA01G416590
OH-1004 ID	LXL04_002851
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 42.005 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G416590`
Location	Chr01:103954404-103957617 (+)
Description	Similar to Putative AC transposase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002851` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0032196 transposition Biological Process GO:0003677 DNA binding Molecular Function GO:0046983 protein dimerization activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.683

Rank 1 · TkA01G416590 · TK1151

Cytoplasm0.329

Rank 2 · TkA01G416590 · TK1151

Cell membrane0.079

Rank 3 · TkA01G416590 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G416590 · TK1151

Lysosome / Vacuole0.023

Rank 5 · TkA01G416590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24818PH_TRF2_HOY1176-294 aa

PF17712DUF5557325-350 aa

PF12646DUF3783356-381 aa

PF17712DUF5557371-394 aa

PF12646DUF3783378-402 aa

PF17712DUF5557416-438 aa

PF12646DUF3783444-468 aa

PF17712DUF5557459-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G416590	`PF24818`	PH_TRF2_HOY1	176	294	2.2e-51	173.5
TkA01G416590	`PF17712`	DUF5557	325	350	0.0029	18.2
TkA01G416590	`PF12646`	DUF3783	356	381	0.16	12.6
TkA01G416590	`PF17712`	DUF5557	371	394	0.0029	18.2
TkA01G416590	`PF12646`	DUF3783	378	402	0.16	12.6
TkA01G416590	`PF17712`	DUF5557	416	438	0.0029	18.2
TkA01G416590	`PF12646`	DUF3783	444	468	0.16	12.6
TkA01G416590	`PF17712`	DUF5557	459	482	0.0029	18.2
TkA01G416590	`PF17712`	DUF5557	528	558	0.0029	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card