TkA01G416160 | RubberDandelionOmics

Gene overview

TkA01G416160

Reference: TK1151 Chr: Chr01 Coordinates: 103834590-103836098 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA01G416160|TK1151|cDNA

TTAACATGGGCTTAGATTCTGATGTGTCAAACCCAAAGAAATATGAGTCATAATCAAGTTACACGTTTTATTCGCTTATCACACAAGCCCAAACCAGAGGATAACAGAGACTCCCATTCTCTCTCTCTCTCTCTCTCTGTCTCTCGGAGAGTTGACAAATGATTCTGTAATCCTGGTTTTTAGCTGTAATCCTGAAGGGGTTTCTGTCTAATTCTTCCATTCATCTGGAAACGCAACCCATTCAAAGTTCCTAAAGTGGA...

CDS

Download CDS FASTA

579 bp · TkA01G416160|TK1151|CDS

ATGGCAAATGAACACGAGAACGACTTAATAGAAATACTGGAAGAGAACCACCCAATCGACATCAACAAGTACACAAATTACGTCCACGCCCCTCAATGCGGGGCCATTGCAACTTTCTACGGCAACACCCGCGACACATTCGAGGGCAAAACGGTCATTGAGCTAAGATACGAAGCGTATGTCCCAATGGCCATCCGATGTCTCAAATCCATCTGTTCATCAGCGAGATCCAAATGGAATCTGAATTCCGTTGCTGTGGC...

Protein

Download Protein FASTA

192 aa · TkA01G416160|TK1151|PROTEIN

MANEHENDLIEILEENHPIDINKYTNYVHAPQCGAIATFYGNTRDTFEGKTVIELRYEAYVPMAIRCLKSICSSARSKWNLNSVAVAHRLGPVAVGETSVFVAVSSVHRVDALDACKFVIDEIKASVPIWKKEVYSNGEVWKENMEFLEKIGEDGYFKRGCCKPKVKVEGDDVAGHVKRGCCREKVKVEDDA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G416160`
TK1151 ID	TkA01G416160
OH-1004 ID	LXL04_002857
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 84.896 / OH-1004 55.631 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G416160

Location Chr01:103834590-103836098 (-)

Description Similar to MOCS2: Molybdopterin synthase catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43760`	Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0140300`	Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin.	No verified direct reference in this release
`UniProt: A2X0R4`	Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002857 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process

GO:0032324 molybdopterin cofactor biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:1990140 molybdopterin synthase complex Cellular Component

GO:0030366 molybdopterin synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G43760

dosa:Os02g0140300

hsa:4338

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.671

Rank 1 · TkA01G416160 · TK1151

Nucleus0.573

Rank 2 · TkA01G416160 · TK1151

Mitochondrion0.060

Rank 3 · TkA01G416160 · TK1151

Cell membrane0.033

Rank 4 · TkA01G416160 · TK1151

Endoplasmic reticulum0.030

Rank 5 · TkA01G416160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02391MoaE16-125 aa

PF05157MshEN84-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G416160	`PF02391`	MoaE	16	125	1.9e-39	135.1
TkA01G416160	`PF05157`	MshEN	84	121	0.1	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22827`	Arabidopsis thaliana	sp\|O22827\|MOC2B_ARATH Molybdopterin synthase catalytic subunit	65.700%	Swiss-Prot	High
`Q6Z2X3`	Oryza sativa subsp. japonica	sp\|Q6Z2X3\|MOC2B_ORYSJ Molybdopterin synthase catalytic subunit	55.100%	Swiss-Prot	High
`A2X0R4`	Oryza sativa subsp. indica	sp\|A2X0R4\|MOC2B_ORYSI Molybdopterin synthase catalytic subunit	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card