TkA01G415260 | RubberDandelionOmics

Gene overview

TkA01G415260

Reference: TK1151 Chr: Chr01 Coordinates: 103617771-103618209 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

376 bp · TkA01G415260|TK1151|cDNA

AACCATTCAAAGTTTCTCTCCATTCCCTTGCATTATTTGGCTGACCAAAATGGCTTTTAATCGGAGACATATTGCAGACATATTGGAGATGGAAACTATCTCTACTAATCAGGAGGATAACGAGTTTACCGTCTTAGCAAAGATAGTCGAACTCGATCATAATTCTGGATGGTGTTATGCTTCATGCTGTAAATGCAACCACAATTTGGAGGCCATCGATGGTTCATTTGTTTGCTCCGTTTGCAATCAACAATGCCGTT...

CDS

Download CDS FASTA

327 bp · TkA01G415260|TK1151|CDS

ATGGCTTTTAATCGGAGACATATTGCAGACATATTGGAGATGGAAACTATCTCTACTAATCAGGAGGATAACGAGTTTACCGTCTTAGCAAAGATAGTCGAACTCGATCATAATTCTGGATGGTGTTATGCTTCATGCTGTAAATGCAACCACAATTTGGAGGCCATCGATGGTTCATTTGTTTGCTCCGTTTGCAATCAACAATGCCGTTATCCCATCATAAGGTATAAAATACATGTGCATGTTATTGACGGAAGTGG...

Protein

Download Protein FASTA

109 aa · TkA01G415260|TK1151|PROTEIN

MAFNRRHIADILEMETISTNQEDNEFTVLAKIVELDHNSGWCYASCCKCNHNLEAIDGSFVCSVCNQQCRYPIIRYKIHVHVIDGSGRTTFVIFNQEAENCLIVVQTNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G415260`
TK1151 ID	TkA01G415260
OH-1004 ID	LXL04_002157
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 93.578 / OH-1004 10.169 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G415260`
Location	Chr01:103617771-103618209 (+)
Description	Similar to pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002157` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0031297 replication fork processing Biological Process GO:0043504 mitochondrial DNA repair Biological Process GO:0051276 chromosome organization Biological Process GO:0071932 replication fork reversal Biological Process GO:1902983 DNA strand elongation involved in mitotic DNA replication Biological Process GO:1903469 removal of RNA primer involved in mitotic DNA replication Biological Process GO:1990426 mitotic recombination-dependent replication fork processing Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	prw:PsycPRwf_1560 spo:2541213 tbr:Tb11.01.6420 xla:734585 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.910

Rank 1 · TkA01G415260 · TK1151

Cytoplasm0.179

Rank 2 · TkA01G415260 · TK1151

Cell membrane0.022

Rank 3 · TkA01G415260 · TK1151

Mitochondrion0.016

Rank 4 · TkA01G415260 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA01G415260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08646Rep_fac-A_C26-102 aa

PF14951DUF450327-82 aa

PF17244CDC24_OB333-102 aa

PF31228BRC-2_C42-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G415260	`PF08646`	Rep_fac-A_C	26	102	2e-09	38.1
TkA01G415260	`PF14951`	DUF4503	27	82	0.001	18.3
TkA01G415260	`PF17244`	CDC24_OB3	33	102	0.016	15.8
TkA01G415260	`PF31228`	BRC-2_C	42	96	0.071	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card