TkA01G412330 | RubberDandelionOmics

Gene overview

TkA01G412330

Reference: TK1151 Chr: Chr01 Coordinates: 102850837-102852620 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1703 bp · TkA01G412330|TK1151|cDNA

AATAAAAATGTGAAATTGTATAAAATAAATAAGAAATAAAATGATGATGTGGAAAATAAAAGTGGATGTTGGATGTTGTGACTATTTCCCCCATTTTGGTGAATGTTGCCTAAGGTATGTTGTCCTATGTTGCATGCCACGTGGAGGGCAACATTCACCCCCAACTAGCAACCCACACCTACCAGCCGAAAAAATCATAATTTATCTAATCATCAAATCTTTTTTATGGCTATTATCTATTCACGTGTCATCACTGTACT...

CDS

Download CDS FASTA

741 bp · TkA01G412330|TK1151|CDS

ATGACGATATTAATTGGGGAATTCCGGCTGATCCAATCAATATTGATGTTAAATTTCCTTGCGACACTTCTCCGGTGGATATCAAATCAATCGACAATGTTATTTCCGGAATCCGATCACCTCCTTGATTTCGATTTCCCTGTTCCAACAGACGCAAAACTTCACAACCACTTTCTTGATCCTGTTAACGACAGTGTGGTTCCGTTCCACGTGACGCCACCGGCTAAGCATTTTCCACCGCCATCGGATAATCGATACGA...

Protein

Download Protein FASTA

246 aa · TkA01G412330|TK1151|PROTEIN

MTILIGEFRLIQSILMLNFLATLLRWISNQSTMLFPESDHLLDFDFPVPTDAKLHNHFLDPVNDSVVPFHVTPPAKHFPPPSDNRYEIDFTRSNINSYNKSNYLSKSLSHSVSSSSIDVGIVPDGSSMSDVSHPFMLQVSGGGELNGATTGNQQAIQLSGIDREARVMRYRQKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRTDSTESDVDRWLFTASPVVSAKCSYSGEAEYGVVPSYRRNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G412330`
TK1151 ID	TkA01G412330
OH-1004 ID	LXL04_002904
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 86.992 / OH-1004 55.297 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G412330

Location Chr01:102850837-102852620 (-)

Description Similar to COL5: Zinc finger protein CONSTANS-LIKE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57660`	Zinc finger protein CONSTANS-LIKE 5.	No verified direct reference in this release
`At5g24930`	Zinc finger protein CONSTANS-LIKE 4.	No verified direct reference in this release
`At3g02380`	Putative transcription factor.	No verified direct reference in this release
`At2g24790`	Zinc finger protein CONSTANS-LIKE 3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0275000`	Probable transcription factor involved in the regulation of flower development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002904 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT2G24790

ath:AT3G02380

ath:AT5G15850

ath:AT5G24930

ath:AT5G57660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.725

Rank 1 · TkA01G412330 · TK1151

Cytoplasm0.305

Rank 2 · TkA01G412330 · TK1151

Cell membrane0.059

Rank 3 · TkA01G412330 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G412330 · TK1151

Mitochondrion0.026

Rank 5 · TkA01G412330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203CCT163-205 aa

PF02045CBFB_NFYA166-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G412330	`PF06203`	CCT	163	205	2.7e-18	66.4
TkA01G412330	`PF02045`	CBFB_NFYA	166	212	0.55	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHH8`	Arabidopsis thaliana	sp\|Q9FHH8\|COL5_ARATH Zinc finger protein CONSTANS-LIKE 5	43.400%	Swiss-Prot	Medium
`Q940T9`	Arabidopsis thaliana	sp\|Q940T9\|COL4_ARATH Zinc finger protein CONSTANS-LIKE 4	47.100%	Swiss-Prot	Medium
`Q96502`	Arabidopsis thaliana	sp\|Q96502\|COL2_ARATH Zinc finger protein CONSTANS-LIKE 2	43.400%	Swiss-Prot	Medium
`Q9SK53`	Arabidopsis thaliana	sp\|Q9SK53\|COL3_ARATH Zinc finger protein CONSTANS-LIKE 3	56.200%	Swiss-Prot	Low
`Q9FDX8`	Oryza sativa subsp. japonica	sp\|Q9FDX8\|HD1_ORYSJ Zinc finger protein HD1	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card