TkA01G399330 | RubberDandelionOmics

Gene overview

TkA01G399330

Reference: TK1151 Chr: Chr01 Coordinates: 99646652-99648518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1243 bp · TkA01G399330|TK1151|cDNA

TAACTTTTTTATGAATAAAGACTTTGCGTTGACGCCTAATCCTTGAAACGCGGTTTCTTTCTTTTCTACCCTGCTTCTTCTTCGTAGTGTACTACGTATGTAATGCACCATCTGATTTCTAAATCTAACACTATCACATGTATTCCGGCAACGCATCTCCATCCTTTTCCTAGACAGCGAGAGATTGATCAATAACCGCCCCAGCTCAGTACCTCCGACAATCCGATGGCTGAATATATCCGTGGGGATTTCAGTAATAT...

CDS

Download CDS FASTA

450 bp · TkA01G399330|TK1151|CDS

ATGGCTGAATATATCCGTGGGGATTTCAGTAATATACGCATGGACATGGACATCGACAATTGGACCTGTCAGATGAGACCTCACTCAAATACTTCCAAGTCGTACAGTAGCGGTGGTCTACCACCGTCCGTCGGAAATGTGAGGCAAATGGTCGTTTCTGAACCTTCCCGCAGTAATCAGATGTATAGCTATGGACAACCACCGTCGGTCAACGACGTAGGCAGAAGAGAACCATCTCAGAGTGAGGCATCCTGCACACG...

Protein

Download Protein FASTA

149 aa · TkA01G399330|TK1151|PROTEIN

MAEYIRGDFSNIRMDMDIDNWTCQMRPHSNTSKSYSSGGLPPSVGNVRQMVVSEPSRSNQMYSYGQPPSVNDVGRREPSQSEASCTRYEGSDEHEVQQITSELNDGVMYKRETFGRSSEINAYSGHDERTQDLVSRIGSKFSESFQVPP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G399330`
TK1151 ID	TkA01G399330
OH-1004 ID	LXL04_003055
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.800
Protein coverage (%)	TK1151 100.000 / OH-1004 54.152 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G399330`
Location	Chr01:99646652-99648518 (+)
Description	Similar to ARF19: Auxin response factor 19
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003055` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009630 gravitropism Biological Process GO:0009638 phototropism Biological Process GO:0009723 response to ethylene Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009785 blue light signaling pathway Biological Process GO:0010311 lateral root formation Biological Process GO:0040008 regulation of growth Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048366 leaf development Biological Process
KEGG gene cross-reference	ath:AT1G19220 ath:AT5G20730 dosa:Os02g0141100 dosa:Os06g0702600 dosa:Os08g0520500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.626

Rank 1 · TkA01G399330 · TK1151

Cytoplasm0.411

Rank 2 · TkA01G399330 · TK1151

Cell membrane0.075

Rank 3 · TkA01G399330 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA01G399330 · TK1151

Mitochondrion0.038

Rank 5 · TkA01G399330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11992TgpA_N20-80 aa

PF08277PAN_350-75 aa

PF08277PAN_381-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G399330	`PF11992`	TgpA_N	20	80	0.063	13.0
TkA01G399330	`PF08277`	PAN_3	50	75	0.13	12.8
TkA01G399330	`PF08277`	PAN_3	81	110	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card