TkA01G398690 | RubberDandelionOmics

Gene overview

TkA01G398690

Reference: TK1151 Chr: Chr01 Coordinates: 99471360-99472972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · TkA01G398690|TK1151|cDNA

GTGGACTGTCAATGATTGAAACTTTGAAAAAGTTGAAAACACGGCTTCACCATTTCTACTCTTCTTCCTTCTTGGTAGTGTAGACTGTAGTGTACGTAGGTAATGCAGCAACTCCAAATTCTAAATCCCACAAGGCAACAATGCCCAAACGCACTATTTTCTCCACGGACATCGACAACTGGACGACGGATAAGAAACCTCAGTCAGGTCTCGCCAATTCGTACAGTAGCGGCGGTCAACCACCGTCTCTTGGAGATGTG...

CDS

Download CDS FASTA

741 bp · TkA01G398690|TK1151|CDS

ATGCCCAAACGCACTATTTTCTCCACGGACATCGACAACTGGACGACGGATAAGAAACCTCAGTCAGGTCTCGCCAATTCGTACAGTAGCGGCGGTCAACCACCGTCTCTTGGAGATGTGAGGAAAATGGTTGTTTCTGAACCTTCCGGCAGTAATCAGATGTACAGAATTGGACAACTTCCGTCGGTCAACGACGTATGTAGACGAGAACCATCTCAAAGTGAGGCGTCCTGCAACCGCTACGACGGTCCTGATGAAAA...

Protein

Download Protein FASTA

246 aa · TkA01G398690|TK1151|PROTEIN

MPKRTIFSTDIDNWTTDKKPQSGLANSYSSGGQPPSLGDVRKMVVSEPSGSNQMYRIGQLPSVNDVCRREPSQSEASCNRYDGPDENEVQQQVMSELNDPRGAVNRSKDITEYSCYGERTEDLLSRFSSHFSGVPPQHPPLKQVQRIGSCVIKVFKSGEIERFVNISAYSGYDKLKQDIARNFGIDGQLEDHGWRLLYADHDEDMLLVGDDPWQEFADCVRYIKILSPQEVQTRLDHDFALKSALY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G398690`
TK1151 ID	TkA01G398690
OH-1004 ID	LXL04_003055
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.100
Protein coverage (%)	TK1151 95.935 / OH-1004 95.307 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G398690

Location Chr01:99471360-99472972 (+)

Description Similar to ARF19: Auxin response factor 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19220`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	A role for auxin response factor 19 in auxin and ethylene signaling in Arabidopsis.2006 · DOI: 10.1104/pp.105.070987 ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047761 Arabidopsis ATXR2 deposits H3K36me3 at the promoters of LBD genes to facilitate cellular dedifferentiation.2017 · DOI: 10.1126/scisignal.aan0316

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0520500`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os02g0141100`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os06g0702600`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`UniProt: A2X1A1`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003055 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009630 gravitropism Biological Process

GO:0009638 phototropism Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0010311 lateral root formation Biological Process

GO:0040008 regulation of growth Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048366 leaf development Biological Process

KEGG gene cross-reference

ath:AT1G19220

ath:AT5G20730

dosa:Os02g0141100

dosa:Os06g0702600

dosa:Os08g0520500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.756

Rank 1 · TkA01G398690 · TK1151

Cytoplasm0.272

Rank 2 · TkA01G398690 · TK1151

Cell membrane0.091

Rank 3 · TkA01G398690 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA01G398690 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA01G398690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309AUX_IAA149-183 aa

PF00564PB1152-211 aa

PF02309AUX_IAA188-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G398690	`PF02309`	AUX_IAA	149	183	4.7e-08	33.8
TkA01G398690	`PF00564`	PB1	152	211	0.012	16.3
TkA01G398690	`PF02309`	AUX_IAA	188	230	4.7e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RYC8`	Arabidopsis thaliana	sp\|Q8RYC8\|ARFS_ARATH Auxin response factor 19	53.900%	Swiss-Prot	Low
`Q6YZW0`	Oryza sativa subsp. japonica	sp\|Q6YZW0\|ARFU_ORYSJ Auxin response factor 21	59.300%	Swiss-Prot	Low
`Q6Z2W3`	Oryza sativa subsp. japonica	sp\|Q6Z2W3\|ARFE_ORYSJ Auxin response factor 5	60.200%	Swiss-Prot	Low
`Q0D9R7`	Oryza sativa subsp. japonica	sp\|Q0D9R7\|ARFS_ORYSJ Auxin response factor 19	51.000%	Swiss-Prot	Low
`A2X1A1`	Oryza sativa subsp. indica	sp\|A2X1A1\|ARFF_ORYSI Auxin response factor 6	49.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card