TkA01G398410 | RubberDandelionOmics

Gene overview

TkA01G398410

Reference: TK1151 Chr: Chr01 Coordinates: 99387387-99397258 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1278 bp · TkA01G398410|TK1151|cDNA

ATGATGTACATGGGGACATCAAGGGACTATGAATACTATGTTGCTGTACGAGTGATGCTTAGATCTCTCACGAAGCTTCGAGTAAATGCAGATCTCGTAGTTATTGCTTCTCGCGACATCCCCCTTCAATGGATACAAACCTTGGAGACAGAAGATGGGGCAAAGGTGGTGAGAGTTGAGAACCTAAATAACCCATACCAAACCGATGCTAACCATAACCGGTTCAGACTAACACTAAATAAATTGTATGCATGGAGCTT...

CDS

Download CDS FASTA

1278 bp · TkA01G398410|TK1151|CDS

ATGATGTACATGGGGACATCAAGGGACTATGAATACTATGTTGCTGTACGAGTGATGCTTAGATCTCTCACGAAGCTTCGAGTAAATGCAGATCTCGTAGTTATTGCTTCTCGCGACATCCCCCTTCAATGGATACAAACCTTGGAGACAGAAGATGGGGCAAAGGTGGTGAGAGTTGAGAACCTAAATAACCCATACCAAACCGATGCTAACCATAACCGGTTCAGACTAACACTAAATAAATTGTATGCATGGAGCTT...

Protein

Download Protein FASTA

425 aa · TkA01G398410|TK1151|PROTEIN

MMYMGTSRDYEYYVAVRVMLRSLTKLRVNADLVVIASRDIPLQWIQTLETEDGAKVVRVENLNNPYQTDANHNRFRLTLNKLYAWSLSEYERVVMLDADNLFLQNTDELFQCGHFCAVFINPCIFHTGLFVLQPSSKVFKTMVHDLDMKRSNLDSADQGFIGGYFSDLLDQPMFHPSPNSTKRLHGTFRLPLGYQMDASYFYLKLRWSVPCGPNSVITFPGAPWLKPWYWWSWPFLPLGIQWHEQRRQTLGYDSEMSVVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G398410`
TK1151 ID	TkA01G398410
OH-1004 ID	LXL04_026605
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.000
Protein coverage (%)	TK1151 62.588 / OH-1004 78.886 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G398410

Location Chr01:99387387-99397258 (-)

Description Similar to PGSIP7: Putative glucuronosyltransferase PGSIP7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35710`	Putative glucuronosyltransferase PGSIP8.	No verified direct reference in this release
`At4g16600`	Putative glucuronosyltransferase PGSIP7.	No verified direct reference in this release
`At5g18480`	Mediates the transfer of glucuronic acid (GlcA) from UDP-GlcA to glycosyl inositol phosphorylceramides (GIPCs).	Identification of a sphingolipid α-glucuronosyltransferase that is essential for pollen function in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129171 Glycosylation of inositol phosphorylceramide sphingolipids is required for normal growth and reproduction in Arabidopsis.2017 · DOI: 10.1111/tpj.13382
`At1g08990`	May be involved in the substitutions of the xylan backbone in stem glucuronoxylan.	No verified direct reference in this release
`UniProt: Q8GWW4`	Glycosyltransferase required for the addition of both glucuronic acid and 4-O-methylglucuronic acid branches to xylan in stem cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026605 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G35710

ath:AT4G16600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.464

Rank 1 · TkA01G398410 · TK1151

Golgi apparatus0.388

Rank 2 · TkA01G398410 · TK1151

Cytoplasm0.114

Rank 3 · TkA01G398410 · TK1151

Nucleus0.093

Rank 4 · TkA01G398410 · TK1151

Cell membrane0.066

Rank 5 · TkA01G398410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_89-111 aa

PF11051Mannosyl_trans334-112 aa

PF01501Glyco_transf_8121-158 aa

PF28460PGSIP7_C217-243 aa

PF28460PGSIP7_C254-410 aa

PF24664Monjiviricetes_fusion293-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G398410	`PF01501`	Glyco_transf_8	9	111	0.00035	20.9
TkA01G398410	`PF11051`	Mannosyl_trans3	34	112	2.7e-06	27.7
TkA01G398410	`PF01501`	Glyco_transf_8	121	158	0.00035	20.9
TkA01G398410	`PF28460`	PGSIP7_C	217	243	2.7e-63	213.5
TkA01G398410	`PF28460`	PGSIP7_C	254	410	2.7e-63	213.5
TkA01G398410	`PF24664`	Monjiviricetes_fusion	293	336	0.34	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZP6`	Arabidopsis thaliana	sp\|Q8VZP6\|GUX8_ARATH Putative glucuronosyltransferase PGSIP8	65.700%	Swiss-Prot	High
`F4JMI5`	Arabidopsis thaliana	sp\|F4JMI5\|GUX7_ARATH Putative glucuronosyltransferase PGSIP7	65.700%	Swiss-Prot	High
`Q8GWB7`	Arabidopsis thaliana	sp\|Q8GWB7\|GUX6_ARATH Inositol phosphorylceramide glucuronosyltransferase 1	29.600%	Swiss-Prot	Low
`F4HZC3`	Arabidopsis thaliana	sp\|F4HZC3\|GUX5_ARATH Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5	31.000%	Swiss-Prot	Low
`Q8GWW4`	Arabidopsis thaliana	sp\|Q8GWW4\|GUX2_ARATH UDP-glucuronate:xylan alpha-glucuronosyltransferase 2	26.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card