TkA01G397330 | RubberDandelionOmics

Gene overview

TkA01G397330

Reference: TK1151 Chr: Chr01 Coordinates: 99092248-99094743 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · TkA01G397330|TK1151|cDNA

AAGGCTTTGATTTGAGCCTTTTCCAAAAGACAACCACACCGCTTCCTTTTCTAAAAGCTATCTTTGCTTCAACGCCTCGCATCCAATGAAATCAGAATCGCAATTACTCCATCGGCTCCTCCACCCAAATCGCAATTACTCCTTAAATCGACGCCCTCATCTCGATGCTTTAACTCCTCTGAAATCGCAATTAATCCTTTCCCTCTGAAATCGCCATCGACCTGCTTTAACTCCTCTGAAATCGCCATCTACCTGCTTCC...

CDS

Download CDS FASTA

435 bp · TkA01G397330|TK1151|CDS

ATGTCATCTCCGACCCCTCCTCCGGCCACCGGAAGAACATCCCGTGGGCCAGTCAGTGTTTCTCGAGATAACACAGCAAAAAATTTGGTCACCGATCAACTATCGCAAGCGGTTCTCTCCACCTCAAATCTTCTTCACATCATGATTCGATCCTCTCCATCTCAGCAGGATAATCTTGTGAAGCTTCCTAAAAACCTTTTGGCTAAAGCGTCTACAATAAAGAACACTCAACAGGTTTTGGAGCAAATGCCTCAGGTGAT...

Protein

Download Protein FASTA

144 aa · TkA01G397330|TK1151|PROTEIN

MSSPTPPPATGRTSRGPVSVSRDNTAKNLVTDQLSQAVLSTSNLLHIMIRSSPSQQDNLVKLPKNLLAKASTIKNTQQVLEQMPQVISSLDAHMDHGLQSVPHLETVTRLLSNIENSQLKPLATLERGKSTAIIRWIFHIIINI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G397330`
TK1151 ID	TkA01G397330
OH-1004 ID	LXL04_003069
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.700
Protein coverage (%)	TK1151 56.250 / OH-1004 67.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G397330

Location Chr01:99092248-99094743 (-)

Description Similar to TOM2B: Tobamovirus multiplication protein 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32370`	Necessary for the efficient intracellular multiplication of tobamoviruses.	Arabidopsis TOBAMOVIRUS MULTIPLICATION (TOM) 2 locus encodes a transmembrane protein that interacts with TOM1.2003 · DOI: 10.1093/emboj/cdg034

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003069 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference

ath:AT1G32370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.498

Rank 1 · TkA01G397330 · TK1151

Cytoplasm0.430

Rank 2 · TkA01G397330 · TK1151

Mitochondrion0.101

Rank 3 · TkA01G397330 · TK1151

Cell membrane0.044

Rank 4 · TkA01G397330 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA01G397330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23195UBQLN120-98 aa

PF16088BORCS725-111 aa

PF06581p31comet32-98 aa

PF20582UPF0758_N36-75 aa

PF20582UPF0758_N104-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G397330	`PF23195`	UBQLN1	20	98	0.55	10.8
TkA01G397330	`PF16088`	BORCS7	25	111	2.9e-06	28.2
TkA01G397330	`PF06581`	p31comet	32	98	0.16	11.8
TkA01G397330	`PF20582`	UPF0758_N	36	75	0.24	12.2
TkA01G397330	`PF20582`	UPF0758_N	104	123	0.24	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H960`	Arabidopsis thaliana	sp\|Q8H960\|TOM2B_ARATH Tobamovirus multiplication protein 2B	64.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card