TkA01G391150 | RubberDandelionOmics

Gene overview

TkA01G391150

Reference: TK1151 Chr: Chr01 Coordinates: 97674709-97677972 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1455 bp · TkA01G391150|TK1151|cDNA

CAATCTGAAATTCTGATTTTGTCGAAGTCGTTTTAGACGCCGCTACTCAAACTCAAAGCCCCTTGGTCAGAACGGTGTCCCTCGCTTTCACCGGAACTGTACCAATTCTGTAACCTGAAGAGATGGGCAGACTCAATGGAAACTTACTACGTAGGTTCGTGAGGAGTAGATCATTTTGCACAGCGGACAATGTTGATGGTAATCTTCCGAGCTCTAAAGTCCAAATCTTCGATCGCCACCTCAAACGCAAACAACGTGAT...

CDS

Download CDS FASTA

1002 bp · TkA01G391150|TK1151|CDS

ATGGGCAGACTCAATGGAAACTTACTACGTAGGTTCGTGAGGAGTAGATCATTTTGCACAGCGGACAATGTTGATGGTAATCTTCCGAGCTCTAAAGTCCAAATCTTCGATCGCCACCTCAAACGCAAACAACGTGATCGGGCTGCATGGTTGATAAATCGGAAAGATTCTTTGGTCAATACTGTGGCTGATAACCTTCTGGATCGTTTGGAGGATGTGAAGAAGACATTTCCTACTACATTATGTTTGGGAGGTTCACT...

Protein

Download Protein FASTA

333 aa · TkA01G391150|TK1151|PROTEIN

MGRLNGNLLRRFVRSRSFCTADNVDGNLPSSKVQIFDRHLKRKQRDRAAWLINRKDSLVNTVADNLLDRLEDVKKTFPTTLCLGGSLEAIRRQVDGRGGIEKLIMMDSSYDMVKLCKDAEKDLSSDNIKTSFLVGDEEFLPIQQSSVDLVISCLGLHWTNDLPGAMIQSRLALKPDGLFLAAIFGGETLKELRIACTIAHMEREGGVSPRISPLAQVRDAGNLLTRAGFTLPGVDVDEYQVRYNSALELIEHLRAMGETN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G391150`
TK1151 ID	TkA01G391150
OH-1004 ID	LXL04_003122
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.399 / OH-1004 94.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G391150

Location Chr01:97674709-97677972 (-)

Description Similar to At1g22800: Putative methyltransferase At1g22800, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22800`	Putative methyltransferase At1g22800, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003122 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0099617 matrix side of mitochondrial inner membrane Cellular Component

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22800

dre:794020

hsa:79133

mmu:69487

pon:100172355

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.934

Rank 1 · TkA01G391150 · TK1151

Cytoplasm0.054

Rank 2 · TkA01G391150 · TK1151

Nucleus0.053

Rank 3 · TkA01G391150 · TK1151

Cell membrane0.015

Rank 4 · TkA01G391150 · TK1151

Plastid0.010

Rank 5 · TkA01G391150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01209Ubie_methyltran91-193 aa

PF08241Methyltransf_1197-180 aa

PF13649Methyltransf_2598-177 aa

PF08242Methyltransf_12102-179 aa

PF13847Methyltransf_31104-185 aa

PF13489Methyltransf_23104-230 aa

PF13489Methyltransf_23223-265 aa

PF08241Methyltransf_11224-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G391150	`PF01209`	Ubie_methyltran	91	193	0.00017	21.7
TkA01G391150	`PF08241`	Methyltransf_11	97	180	1.6e-09	38.9
TkA01G391150	`PF13649`	Methyltransf_25	98	177	2.7e-07	31.9
TkA01G391150	`PF08242`	Methyltransf_12	102	179	0.00022	22.6
TkA01G391150	`PF13847`	Methyltransf_31	104	185	0.0025	18.3
TkA01G391150	`PF13489`	Methyltransf_23	104	230	0.042	14.3
TkA01G391150	`PF13489`	Methyltransf_23	223	265	0.042	14.3
TkA01G391150	`PF08241`	Methyltransf_11	224	243	1.6e-09	38.9
TkA01G391150	`PF13649`	Methyltransf_25	261	261	2.7e-07	31.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80543`	Arabidopsis thaliana	sp\|O80543\|Y1280_ARATH Putative methyltransferase At1g22800, mitochondrial	73.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card