TkA01G390560 | RubberDandelionOmics

Gene overview

TkA01G390560

Reference: TK1151 Chr: Chr01 Coordinates: 97504539-97507816 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2580 bp · TkA01G390560|TK1151|cDNA

AGACATTAAATATGAGTTTTTGACCGAAATAGCCTGATTCTACAAAAGTCTTCCACTAAATAGCAAAAAAAAGACACATTCCCGAAATAGCCATCCATTTCGCAGAGAAAAACCAATTTCGCAGAGGATGGTCTCTGTGAAATCCATTTCGCAGTAAAAACTCCATTTCGCAATGCATGCTCTGCGAAACCGCACAGCACATCAGTTAAACCGCAGAGCAGTCTGTTTCGTGACCCCCACCCCATTTCGTGAACCACTCT...

CDS

Download CDS FASTA

2238 bp · TkA01G390560|TK1151|CDS

ATGGAAGAAATCTTTGATGATGGATTCAGAAGCATGCATACTAGGCTTGATATAACAGTGGATGTAACAATGAAGGCGGCCATTCGTATTGTCGTTAGGGACTACTTTCCTAAACTAAGCGATAAACAAAAGGAATTATTTAGGACAGGGGCATTTGGGCAATTTCTGGACATACCAGCAGCGAATGGAGACCCATTGCTTGTAAATACGATGATGCTGCACGAGGTGCGTTCACATGCCTTGGCAAGTGAGGGGCGTTT...

Protein

Download Protein FASTA

746 aa · TkA01G390560|TK1151|PROTEIN

MEEIFDDGFRSMHTRLDITVDVTMKAAIRIVVRDYFPKLSDKQKELFRTGAFGQFLDIPAANGDPLLVNTMMLHEVRSHALASEGRFGFNVQGISMQYGSMEFCLITGLKFGPFTNLIGDTKNPKKSKLRSRLFKDEIDQTLRLSHLEEFIVGKRFSKVPDEDAVMIMQMFFLLRGMLGREWSSCIPPLVLELADNHRNWNMFSWGSFLWSYTEVQMRQIFKKQEEYIREYGGIEGVKKLKYTVLGFIYPFKIWIWETFP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G390560`
TK1151 ID	TkA01G390560
OH-1004 ID	LXL04_009034
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.800
Protein coverage (%)	TK1151 28.686 / OH-1004 99.535 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G390560`
Location	Chr01:97504539-97507816 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009034` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.920

Rank 1 · TkA01G390560 · TK1151

Cytoplasm0.172

Rank 2 · TkA01G390560 · TK1151

Cell membrane0.026

Rank 3 · TkA01G390560 · TK1151

Mitochondrion0.020

Rank 4 · TkA01G390560 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA01G390560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29561DUF856635-228 aa

PF09331DUF198589-207 aa

PF22129CjCas9_WED-like221-239 aa

PF02902Peptidase_C48407-425 aa

PF15699NPR1_interact412-441 aa

PF02902Peptidase_C48638-746 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G390560	`PF29561`	DUF8566	35	228	0.0017	18.9
TkA01G390560	`PF09331`	DUF1985	89	207	1.1e-07	32.7
TkA01G390560	`PF22129`	CjCas9_WED-like	221	239	0.082	13.3
TkA01G390560	`PF02902`	Peptidase_C48	407	425	1.1e-10	42.4
TkA01G390560	`PF15699`	NPR1_interact	412	441	0.2	13.0
TkA01G390560	`PF02902`	Peptidase_C48	638	746	1.1e-10	42.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card