TkA01G385890 | RubberDandelionOmics

Gene overview

TkA01G385890

Reference: TK1151 Chr: Chr01 Coordinates: 96329488-96330558 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · TkA01G385890|TK1151|cDNA

ATGGAGGGAGAGGTGGACAACTTCATTGTGGTTTGGATAGTAGTATTGCCATGTCTTCTTTATTGTTACATAGTCGGGAGGTTGATCCCCCAAGGTACCACTAGACTTGTAGCTTTGTCCATAGTTACATGCCTCTTTCTATGGCTTCCACTCAAGTTAACCACCATGCACCTTGGTGGTTTAACCTCTTTCTTTATAGCTTGGCTTGCCAATTTTAAACTTCTTCTCTTCGCTTATGGGAAAGGCCCTCTTTCTTCAAA...

CDS

Download CDS FASTA

1005 bp · TkA01G385890|TK1151|CDS

ATGGAGGGAGAGGTGGACAACTTCATTGTGGTTTGGATAGTAGTATTGCCATGTCTTCTTTATTGTTACATAGTCGGGAGGTTGATCCCCCAAGGTACCACTAGACTTGTAGCTTTGTCCATAGTTACATGCCTCTTTCTATGGCTTCCACTCAAGTTAACCACCATGCACCTTGGTGGTTTAACCTCTTTCTTTATAGCTTGGCTTGCCAATTTTAAACTTCTTCTCTTCGCTTATGGGAAAGGCCCTCTTTCTTCAAA...

Protein

Download Protein FASTA

334 aa · TkA01G385890|TK1151|PROTEIN

MEGEVDNFIVVWIVVLPCLLYCYIVGRLIPQGTTRLVALSIVTCLFLWLPLKLTTMHLGGLTSFFIAWLANFKLLLFAYGKGPLSSNPPIPLLLFIPMACLPIKTARTSSSGPQSSTKVYDYNEYIHPKVKMSLYCIHIYFMLEIVLAMVAYMARTLVQMELEPQFDEPYLATSLQDFWGRRWNLMVTSILHPTIYDPVRSISMCFMSRQWASLVAIFTSFLVSGLMHEFIFYNIGRLKPTGEVTCFFLLHGVLVSVEVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G385890`
TK1151 ID	TkA01G385890
OH-1004 ID	LXL04_003202
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G385890

Location Chr01:96329488-96330558 (-)

Description Similar to ASAT1: Acyl-CoA--sterol O-acyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51970`	Involved in the esterification of cycloartenol.	Biosynthesis of phytosterol esters: identification of a sterol o-acyltransferase in Arabidopsis.2007 · DOI: 10.1104/pp.107.106278 Involvement of the phospholipid sterol acyltransferase1 in plant sterol homeostasis and leaf senescence.2010 · DOI: 10.1104/pp.109.145672
`At5g55340`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release
`At5g55350`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release
`At5g55360`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003202 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0016127 sterol catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0047196 long-chain-alcohol O-fatty-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51970

ath:AT5G55340

ath:AT5G55350

ath:AT5G55360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.787

Rank 1 · TkA01G385890 · TK1151

Cell membrane0.078

Rank 2 · TkA01G385890 · TK1151

Nucleus0.068

Rank 3 · TkA01G385890 · TK1151

Golgi apparatus0.066

Rank 4 · TkA01G385890 · TK1151

Cytoplasm0.058

Rank 5 · TkA01G385890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04138GtrA_DPMS_TM43-72 aa

PF13813MBOAT_2163-249 aa

PF04138GtrA_DPMS_TM205-291 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G385890	`PF04138`	GtrA_DPMS_TM	43	72	0.0057	17.6
TkA01G385890	`PF13813`	MBOAT_2	163	249	8.3e-21	74.8
TkA01G385890	`PF04138`	GtrA_DPMS_TM	205	291	0.0057	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV07`	Arabidopsis thaliana	sp\|Q9SV07\|ASAT1_ARATH Acyl-CoA--sterol O-acyltransferase 1	43.500%	Swiss-Prot	Medium
`Q9FJ76`	Arabidopsis thaliana	sp\|Q9FJ76\|WAXS5_ARATH Probable long-chain-alcohol O-fatty-acyltransferase 5	41.900%	Swiss-Prot	Medium
`Q9FJ75`	Arabidopsis thaliana	sp\|Q9FJ75\|WAXS4_ARATH Probable long-chain-alcohol O-fatty-acyltransferase 4	41.400%	Swiss-Prot	Medium
`Q9FJ74`	Arabidopsis thaliana	sp\|Q9FJ74\|WAXS3_ARATH Probable long-chain-alcohol O-fatty-acyltransferase 3	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card