TkA01G385630 | RubberDandelionOmics

Gene overview

TkA01G385630

Reference: TK1151 Chr: Chr01 Coordinates: 96246417-96246947 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

435 bp · TkA01G385630|TK1151|cDNA

ATGAGACTCAAAGTGGTCGCACCAAAGTGTTGCAAAGAAGTCATTAAACATAACGATTATGAAAGCTTATATGTCCATCCTTGGGTCAGCCAATCTTCAAACGCAAAGCTCAGTCCGAAAAGCCTTGCACTTTGCACTGAAAGCTTAGGGAATGAGACCGGGAGTGACACTACCCAAGGAAGCGTGCCTTTGTTCTCAAAGTCCAACAAATTGGACAAAAGGAGCCAAATGGGATCAAAGAAAGTGGTCTCTCGTGGCTT...

CDS

Download CDS FASTA

435 bp · TkA01G385630|TK1151|CDS

ATGAGACTCAAAGTGGTCGCACCAAAGTGTTGCAAAGAAGTCATTAAACATAACGATTATGAAAGCTTATATGTCCATCCTTGGGTCAGCCAATCTTCAAACGCAAAGCTCAGTCCGAAAAGCCTTGCACTTTGCACTGAAAGCTTAGGGAATGAGACCGGGAGTGACACTACCCAAGGAAGCGTGCCTTTGTTCTCAAAGTCCAACAAATTGGACAAAAGGAGCCAAATGGGATCAAAGAAAGTGGTCTCTCGTGGCTT...

Protein

Download Protein FASTA

144 aa · TkA01G385630|TK1151|PROTEIN

MRLKVVAPKCCKEVIKHNDYESLYVHPWVSQSSNAKLSPKSLALCTESLGNETGSDTTQGSVPLFSKSNKLDKRSQMGSKKVVSRGFPPPLTAISSLSLLQISHHREGGRLIIQAMEAPYKNSCFQVERSQGRLRLMCSKSMSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G385630`
TK1151 ID	TkA01G385630
OH-1004 ID	LXL04_003207
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.800
Protein coverage (%)	TK1151 100.000 / OH-1004 88.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G385630

Location Chr01:96246417-96246947 (-)

Description Similar to FAF3: Protein FANTASTIC FOUR 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19260`	Able to repress WUS when constitutively overexpressed, but have no effect on CLV3.	No verified direct reference in this release
`At3g06020`	Regulates the size of the shoot meristem by modulating the CLV3-WUS feedback loop.	The FANTASTIC FOUR proteins influence shoot meristem size in Arabidopsis thaliana.2010 · DOI: 10.1186/1471-2229-10-285
`At1g03170`	Regulates the size of the shoot meristem by modulating the CLV3-WUS feedback loop.	The FANTASTIC FOUR proteins influence shoot meristem size in Arabidopsis thaliana.2010 · DOI: 10.1186/1471-2229-10-285

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003207 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0042326 negative regulation of phosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019902 phosphatase binding Molecular Function

GO:0072542 protein phosphatase activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G03170

ath:AT3G06020

ath:AT4G02810

ath:AT5G19260

ath:AT5G22090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA01G385630 · TK1151

Nucleus0.411

Rank 2 · TkA01G385630 · TK1151

Cell membrane0.252

Rank 3 · TkA01G385630 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA01G385630 · TK1151

Plastid0.049

Rank 5 · TkA01G385630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11250FAF87-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G385630	`PF11250`	FAF	87	137	9.2e-16	58.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NMR8`	Arabidopsis thaliana	sp\|Q6NMR8\|FAF3_ARATH Protein FANTASTIC FOUR 3	44.200%	Swiss-Prot	Medium
`Q9SFG6`	Arabidopsis thaliana	sp\|Q9SFG6\|FAF4_ARATH Protein FANTASTIC FOUR 4	38.500%	Swiss-Prot	Medium
`Q8GXU9`	Arabidopsis thaliana	sp\|Q8GXU9\|FAF2_ARATH Protein FANTASTIC FOUR 2	34.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card