TkA01G385600 | RubberDandelionOmics

Gene overview

TkA01G385600

Reference: TK1151 Chr: Chr01 Coordinates: 96230604-96232950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1931 bp · TkA01G385600|TK1151|cDNA

TTCAAATCAAGTGAAGATATTACAATGAACAAAACACGATCTAATAACTAATAAACCCTAAAAATCATTATTTAAACCCAAAAAAAAAAATACAGATGCTCAGAAAATAGGAAAAAGTCGCATTTCACGTACCTTGGACTGGAGCGATTGTGATTGCTTATGCTTCAAAGAAAAGAAGAAAAATGAGGAAAGCTATAGGGTTATCAGATTGGAGCATAAGTGCATAACTTGATTGCTTTTGCCATTGTGAGTATGCTTCT...

CDS

Download CDS FASTA

1242 bp · TkA01G385600|TK1151|CDS

ATGAAGAAATCCGAGCGAGCAAAGGCAACAAAACTCGAAGATGGGGTCGATTTGCTTAGTAGCATGCCGGATGCTGTTCTTGTTTTGATTCTTTCACGTCTTTCATCCACTGAAGAACAAATCCGAAGCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCACTAGACATGCGTTTTGAAGCCATTCCTCGCGGACGAAAATTCACAAAAAACGAATTCAAAGAGTTTATGTATTGGGTTTCAAC...

Protein

Download Protein FASTA

413 aa · TkA01G385600|TK1151|PROTEIN

MKKSERAKATKLEDGVDLLSSMPDAVLVLILSRLSSTEEQIRSSILSRRWRYLWTAVPSLDMRFEAIPRGRKFTKNEFKEFMYWVSTSKTVDLDSFRLFCSDYYSMSTVWRWIHVAVKRNVKQLNLSCCAKEETEAIELPHCLVSCASLEVLTLILAFSGLRLPKFVGFPALRVLHLTRIVILEDDDLVKDFLESCPSLEDLTLYDCLLRKLDLLWISCPKLKTLRIVGFWENEGCDGIKISCPKLVYMDLIGYIAGNFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G385600`
TK1151 ID	TkA01G385600
OH-1004 ID	LXL04_003214
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G385600

Location Chr01:96230604-96232950 (-)

Description Similar to At2g26860: FBD-associated F-box protein At2g26860

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At4g14103`	F-box/LRR-repeat protein At4g14103.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003214 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT1G69630

ath:AT2G26860

ath:AT5G56420

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.834

Rank 1 · TkA01G385600 · TK1151

Cytoplasm0.211

Rank 2 · TkA01G385600 · TK1151

Cell membrane0.044

Rank 3 · TkA01G385600 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G385600 · TK1151

Plastid0.017

Rank 5 · TkA01G385600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box19-58 aa

PF12937F-box-like20-53 aa

PF23622LRR_At1g61320_AtMIF189-355 aa

PF07723LRR_289-102 aa

PF24758LRR_At5g56370111-207 aa

PF25019LRR_R13L1-DRL21117-206 aa

PF07723LRR_2121-130 aa

PF12799LRR_4139-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G385600	`PF00646`	F-box	19	58	4.7e-06	27.0
TkA01G385600	`PF12937`	F-box-like	20	53	0.0014	19.1
TkA01G385600	`PF23622`	LRR_At1g61320_AtMIF1	89	355	4.2e-16	60.0
TkA01G385600	`PF07723`	LRR_2	89	102	0.0095	17.3
TkA01G385600	`PF24758`	LRR_At5g56370	111	207	7.2e-17	62.5
TkA01G385600	`PF25019`	LRR_R13L1-DRL21	117	206	0.0049	17.5
TkA01G385600	`PF07723`	LRR_2	121	130	0.0095	17.3
TkA01G385600	`PF12799`	LRR_4	139	154	3e-06	28.0
TkA01G385600	`PF12799`	LRR_4	155	179	3e-06	28.0
TkA01G385600	`PF07723`	LRR_2	172	197	0.0095	17.3
TkA01G385600	`PF12799`	LRR_4	197	227	3e-06	28.0
TkA01G385600	`PF24758`	LRR_At5g56370	211	273	7.2e-17	62.5
TkA01G385600	`PF07723`	LRR_2	221	231	0.0095	17.3
TkA01G385600	`PF25019`	LRR_R13L1-DRL21	288	349	0.0049	17.5
TkA01G385600	`PF12937`	F-box-like	294	302	0.0014	19.1
TkA01G385600	`PF24758`	LRR_At5g56370	302	351	7.2e-17	62.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	31.000%	Swiss-Prot	Medium
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	27.900%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	34.100%	Swiss-Prot	Medium
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	27.800%	Swiss-Prot	Low
`Q8L7H1`	Arabidopsis thaliana	sp\|Q8L7H1\|FBL75_ARATH F-box/LRR-repeat protein At4g14103	27.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card