TkA01G385430 | RubberDandelionOmics

Gene overview

TkA01G385430

Reference: TK1151 Chr: Chr01 Coordinates: 96198649-96200605 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1472 bp · TkA01G385430|TK1151|cDNA

TTATTCTTTCCCTCCAAAATTCCGAAACCCTAACCCTTCACTCAACGACGCGGGTCTGTGAGCCTCTCAGTCATGTGACTACGCTGGCGACGAGCATCTCCATTTCAAGTAGGCATGGAGAAATCCGAACGATCAAAGGCATCAAAATGGAAAGATGGGGTTGATTTGATCAGTAAAATGCCGGATGCTATTCTTCTTTTGATTCTTTCACGTCTTTCATCCACTGAAGAACAAATCCGAAGCAGCATTTTGTCCCGGCG...

CDS

Download CDS FASTA

1155 bp · TkA01G385430|TK1151|CDS

ATGGAGAAATCCGAACGATCAAAGGCATCAAAATGGAAAGATGGGGTTGATTTGATCAGTAAAATGCCGGATGCTATTCTTCTTTTGATTCTTTCACGTCTTTCATCCACTGAAGAACAAATCCGAAGCAGCATTTTGTCCCGGCGATGGAGCTATTTGTGGACTGCAATTCCCTCAGTAGACATGGAATTTGTATCTGAAGGAAAGTTCAAAAAATGCGAATTTAAAGAGTTTGTTTATTGGGTTTTAGCAAGTAAAAC...

Protein

Download Protein FASTA

384 aa · TkA01G385430|TK1151|PROTEIN

MEKSERSKASKWKDGVDLISKMPDAILLLILSRLSSTEEQIRSSILSRRWSYLWTAIPSVDMEFVSEGKFKKCEFKEFVYWVLASKTVDLDRFRLFLNDSDIMSTVWRWVHLAVTRNVKQIDISFSTLKDTKPIELPHYLVSCGSLEVLRLDLKNQSLSLPRFLGFSALRVLDLTYVDLPEDGDLIKDFLKNCPLLEDLSLSCCFIGELVCISCPNLKRLSIVNWDDVGCHGFKICCPKLVDLELGGRILFGNTDPVLFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G385430`
TK1151 ID	TkA01G385430
OH-1004 ID	LXL04_003223
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 97.396 / OH-1004 67.754 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G385430

Location Chr01:96198649-96200605 (-)

Description Similar to At4g10400: FBD-associated F-box protein At4g10400

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At5g38590`	FBD-associated F-box protein At5g38590.	No verified direct reference in this release
`At4g03220`	Putative F-box/FBD/LRR-repeat protein At4g03220.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003223 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G55030

ath:AT1G69630

ath:AT3G28410

ath:AT4G10400

ath:AT5G02700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.850

Rank 1 · TkA01G385430 · TK1151

Cytoplasm0.194

Rank 2 · TkA01G385430 · TK1151

Cell membrane0.041

Rank 3 · TkA01G385430 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA01G385430 · TK1151

Plastid0.017

Rank 5 · TkA01G385430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box19-55 aa

PF12937F-box-like19-52 aa

PF23622LRR_At1g61320_AtMIF131-53 aa

PF23622LRR_At1g61320_AtMIF186-301 aa

PF24758LRR_At5g56370108-223 aa

PF12799LRR_4117-155 aa

PF12799LRR_4146-176 aa

PF00646F-box178-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G385430	`PF00646`	F-box	19	55	0.00014	22.4
TkA01G385430	`PF12937`	F-box-like	19	52	0.0078	16.7
TkA01G385430	`PF23622`	LRR_At1g61320_AtMIF1	31	53	2.2e-09	37.9
TkA01G385430	`PF23622`	LRR_At1g61320_AtMIF1	86	301	2.2e-09	37.9
TkA01G385430	`PF24758`	LRR_At5g56370	108	223	1.3e-13	51.9
TkA01G385430	`PF12799`	LRR_4	117	155	0.0012	19.8
TkA01G385430	`PF12799`	LRR_4	146	176	0.0012	19.8
TkA01G385430	`PF00646`	F-box	178	204	0.00014	22.4
TkA01G385430	`PF12799`	LRR_4	196	222	0.0012	19.8
TkA01G385430	`PF12799`	LRR_4	236	247	0.0012	19.8
TkA01G385430	`PF12937`	F-box-like	267	274	0.0078	16.7
TkA01G385430	`PF12799`	LRR_4	277	296	0.0012	19.8
TkA01G385430	`PF24758`	LRR_At5g56370	286	321	1.3e-13	51.9
TkA01G385430	`PF23622`	LRR_At1g61320_AtMIF1	289	343	2.2e-09	37.9
TkA01G385430	`PF00646`	F-box	307	321	0.00014	22.4
TkA01G385430	`PF12937`	F-box-like	307	320	0.0078	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	27.500%	Swiss-Prot	Low
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	25.700%	Swiss-Prot	Low
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	30.900%	Swiss-Prot	Medium
`Q9FFW2`	Arabidopsis thaliana	sp\|Q9FFW2\|FBD17_ARATH FBD-associated F-box protein At5g38590	27.200%	Swiss-Prot	Low
`Q9ZR09`	Arabidopsis thaliana	sp\|Q9ZR09\|FDL25_ARATH Putative F-box/FBD/LRR-repeat protein At4g03220	23.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card