TkA01G384750 | RubberDandelionOmics

Gene overview

TkA01G384750

Reference: TK1151 Chr: Chr01 Coordinates: 96032100-96032906 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

741 bp · TkA01G384750|TK1151|cDNA

ATGCCGGATGCCACTGAAGAAGAAATTCGAAGCAGCATTTTGTCCAGAAGATGGAGGTATCTGTGGACTGCAGAAGAATCCAAACAAAGCGAATTTAAAGAGTTTATGTATTGGGTTTTAGCAAGCAAAACTGTAAATTTAGATAGTTTTCGTCTAAGTTTCTATAAATGGGACAGTATAGCAACAGTCTGGCGGTGGGTTCATTTGGCAGTTATGAGAAACGTCAAACAAATTGACTTGTTGTTTGGTTATAAAGAGAA...

CDS

Download CDS FASTA

741 bp · TkA01G384750|TK1151|CDS

ATGCCGGATGCCACTGAAGAAGAAATTCGAAGCAGCATTTTGTCCAGAAGATGGAGGTATCTGTGGACTGCAGAAGAATCCAAACAAAGCGAATTTAAAGAGTTTATGTATTGGGTTTTAGCAAGCAAAACTGTAAATTTAGATAGTTTTCGTCTAAGTTTCTATAAATGGGACAGTATAGCAACAGTCTGGCGGTGGGTTCATTTGGCAGTTATGAGAAACGTCAAACAAATTGACTTGTTGTTTGGTTATAAAGAGAA...

Protein

Download Protein FASTA

246 aa · TkA01G384750|TK1151|PROTEIN

MPDATEEEIRSSILSRRWRYLWTAEESKQSEFKEFMYWVLASKTVNLDSFRLSFYKWDSIATVWRWVHLAVMRNVKQIDLLFGYKEKTKAIELPHYLVSCGSLEVLKLNLKTKSLSLPRSVGFPALRVLHLTYVDLPEDDDLVNNFLRSCPLLEDLVLVCCRFRGPVCISCPKLKRLSIVDRYDYMGPHGIKISCPKLVDLDLGGCKWEEDDPDTLQFHGNSHFKWVHIYFFWEVIFFNLVKKNSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G384750`
TK1151 ID	TkA01G384750
OH-1004 ID	LXL04_003213
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.700
Protein coverage (%)	TK1151 94.715 / OH-1004 25.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G384750

Location Chr01:96032100-96032906 (-)

Description Similar to At1g16930: F-box/FBD/LRR-repeat protein At1g16930

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At4g09920`	F-box protein At4g09920.	No verified direct reference in this release
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At3g44060`	Putative F-box protein At3g44060.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003213 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT3G26922

ath:AT4G00160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.822

Rank 1 · TkA01G384750 · TK1151

Cytoplasm0.183

Rank 2 · TkA01G384750 · TK1151

Cell membrane0.040

Rank 3 · TkA01G384750 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA01G384750 · TK1151

Plastid0.017

Rank 5 · TkA01G384750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF143-206 aa

PF07723LRR_243-52 aa

PF24758LRR_At5g5637065-181 aa

PF12799LRR_4102-133 aa

PF07723LRR_2126-151 aa

PF07723LRR_2153-165 aa

PF12799LRR_4155-179 aa

PF07723LRR_2173-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G384750	`PF23622`	LRR_At1g61320_AtMIF1	43	206	2.3e-09	37.9
TkA01G384750	`PF07723`	LRR_2	43	52	0.0021	19.3
TkA01G384750	`PF24758`	LRR_At5g56370	65	181	2.3e-14	54.3
TkA01G384750	`PF12799`	LRR_4	102	133	0.00032	21.6
TkA01G384750	`PF07723`	LRR_2	126	151	0.0021	19.3
TkA01G384750	`PF07723`	LRR_2	153	165	0.0021	19.3
TkA01G384750	`PF12799`	LRR_4	155	179	0.00032	21.6
TkA01G384750	`PF07723`	LRR_2	173	179	0.0021	19.3
TkA01G384750	`PF24758`	LRR_At5g56370	194	212	2.3e-14	54.3
TkA01G384750	`PF12799`	LRR_4	194	207	0.00032	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	31.800%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	32.000%	Swiss-Prot	Medium
`Q9T0F1`	Arabidopsis thaliana	sp\|Q9T0F1\|FB226_ARATH F-box protein At4g09920	31.200%	Swiss-Prot	Medium
`Q9SV82`	Arabidopsis thaliana	sp\|Q9SV82\|FBD40_ARATH FBD-associated F-box protein At4g10400	30.700%	Swiss-Prot	Medium
`Q9LXQ6`	Arabidopsis thaliana	sp\|Q9LXQ6\|FB193_ARATH Putative F-box protein At3g44060	27.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card