TkA01G382650 | RubberDandelionOmics

Gene overview

TkA01G382650

Reference: TK1151 Chr: Chr01 Coordinates: 95514011-95514559 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · TkA01G382650|TK1151|cDNA

CGTTTTGATATACGATTTTATCTTGTTTCTATTTTATTTATTATCCCTGATCCGGAAGTCACCTTTTTAGATGCACATATCCCTCCGGGAGGGCGATTGGGACGTGGGCATAAGGGCCTTTATGACACAATTAATAATTCGCTTCATTTTCAATTAGGCCTTGCTCTAGCTTCTTTAGGGGTTATTACTTCTTTGGTAGCTCAACACGTGTACTCTTTACCCGCTTATGCATTTATAGCACAAGACTTTACTACTCAAGC...

CDS

Download CDS FASTA

549 bp · TkA01G382650|TK1151|CDS

CGTTTTGATATACGATTTTATCTTGTTTCTATTTTATTTATTATCCCTGATCCGGAAGTCACCTTTTTAGATGCACATATCCCTCCGGGAGGGCGATTGGGACGTGGGCATAAGGGCCTTTATGACACAATTAATAATTCGCTTCATTTTCAATTAGGCCTTGCTCTAGCTTCTTTAGGGGTTATTACTTCTTTGGTAGCTCAACACGTGTACTCTTTACCCGCTTATGCATTTATAGCACAAGACTTTACTACTCAAGC...

Protein

Download Protein FASTA

182 aa · TkA01G382650|TK1151|PROTEIN

RFDIRFYLVSILFIIPDPEVTFLDAHIPPGGRLGRGHKGLYDTINNSLHFQLGLALASLGVITSLVAQHVYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLEHKEAIISHLSWASLFLGFHTLELYVHNDVMLAFDKEAMYLTSKGLAFFLVD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G382650`
TK1151 ID	TkA01G382650
OH-1004 ID	LXL04_035807
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 12.637 / OH-1004 2.388 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G382650`
Location	Chr01:95514011-95514559 (-)
Description	Similar to RAP2-4: Ethylene-responsive transcription factor RAP2-4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035807` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009415 response to water Biological Process GO:0009416 response to light stimulus Biological Process GO:0009611 response to wounding Biological Process GO:0009620 response to fungus Biological Process GO:0009651 response to salt stress Biological Process GO:0009736 cytokinin-activated signaling pathway Biological Process
KEGG gene cross-reference	ath:AT1G22190 ath:AT1G36060 ath:AT1G78080 ath:AT2G22200 ath:AT4G39780 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.602

Rank 1 · TkA01G382650 · TK1151

Mitochondrion0.209

Rank 2 · TkA01G382650 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA01G382650 · TK1151

Cytoplasm0.074

Rank 4 · TkA01G382650 · TK1151

Nucleus0.033

Rank 5 · TkA01G382650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00507Oxidored_q41-23 aa

PF00223PsaA_PsaB22-167 aa

PF24187DUF741538-64 aa

PF09679TraQ53-80 aa

PF00507Oxidored_q494-101 aa

PF00507Oxidored_q4160-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G382650	`PF00507`	Oxidored_q4	1	23	0.0028	18.5
TkA01G382650	`PF00223`	PsaA_PsaB	22	167	4.8e-74	250.6
TkA01G382650	`PF24187`	DUF7415	38	64	0.24	12.3
TkA01G382650	`PF09679`	TraQ	53	80	0.024	15.6
TkA01G382650	`PF00507`	Oxidored_q4	94	101	0.0028	18.5
TkA01G382650	`PF00507`	Oxidored_q4	160	172	0.0028	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card