TkA01G381610 | RubberDandelionOmics

Gene overview

TkA01G381610

Reference: TK1151 Chr: Chr01 Coordinates: 95317855-95321975 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2451 bp · TkA01G381610|TK1151|cDNA

TCTCTTTCTCTCTCTCTCTCTCTTTTGTTTTTGTAGTATTCGACAAACATATGCATTCCATTTTGGTTTCTTCACTGATTGGATCAACTGAATCCAGCTGAACACAGAAACAATAAGGTAAACTGATTGGGTTTGAAAGAATTGAATCGATTCCATGGCTTTTGGGGGTTTTCAGGTAAGTGGGATTCTGTTTATAATCAAATGGGTTTTTGTTTAATTGAATTTAGAATGATAATTTTTTGGTCTCCCCCGAATTTCTT...

CDS

Download CDS FASTA

1653 bp · TkA01G381610|TK1151|CDS

ATGGAGAATATGAATGAAGAAATTGATTTGGGGCTTTCTCTTGGTGTTGCAAACCAACGTGTTGAGTCGTGTAGTGGTTCAGGTGCAGGTGCAGGTGCAAATGCAAATTTAAGGTCAAGAATCGATAATACAAAGCCATTTGTGAGACCATGTCCTTTAACCGAGTTGGTTTGGTCTACACAAAATGGTCTAACCATCAAGTGTGCTGGCTGCAGCCGATGTTTAGATGGCCCTTTTTTAAGACCAACTCTTGGTCACAC...

Protein

Download Protein FASTA

550 aa · TkA01G381610|TK1151|PROTEIN

MENMNEEIDLGLSLGVANQRVESCSGSGAGAGANANLRSRIDNTKPFVRPCPLTELVWSTQNGLTIKCAGCSRCLDGPFLRPTLGHTGQQNRRTADLLPLLSNEQEKLEIKTENTDRFTLDVALPLKMQDMTQKEDLKEGCSSPFHEKMEETAENDVQDLIVKDSILENSERGGENRGEGCEEEEEEEDENHESMESCNSGNLSTKRNKGWRFEEQLIIGSKRIKKQSQDYCPTVKQDSSFMNWISNMVKGVKQDHDPRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G381610`
TK1151 ID	TkA01G381610
OH-1004 ID	LXL04_003251
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 89.836 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G381610`
Location	Chr01:95317855-95321975 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003251` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA01G381610 · TK1151

Cytoplasm0.082

Rank 2 · TkA01G381610 · TK1151

Cell membrane0.033

Rank 3 · TkA01G381610 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA01G381610 · TK1151

Plastid0.013

Rank 5 · TkA01G381610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25160LdpA_Fe-S-bd42-75 aa

PF03126Plus-370-132 aa

PF16322Tub_N126-209 aa

PF25160LdpA_Fe-S-bd367-376 aa

PF27939DUF8363368-393 aa

PF30379SLU7_N368-385 aa

PF00098zf-CCHC370-384 aa

PF03126Plus-3431-525 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G381610	`PF25160`	LdpA_Fe-S-bd	42	75	0.36	11.4
TkA01G381610	`PF03126`	Plus-3	70	132	8.6e-10	39.8
TkA01G381610	`PF16322`	Tub_N	126	209	0.036	15.2
TkA01G381610	`PF25160`	LdpA_Fe-S-bd	367	376	0.36	11.4
TkA01G381610	`PF27939`	DUF8363	368	393	0.015	15.8
TkA01G381610	`PF30379`	SLU7_N	368	385	0.017	15.3
TkA01G381610	`PF00098`	zf-CCHC	370	384	0.017	15.9
TkA01G381610	`PF03126`	Plus-3	431	525	8.6e-10	39.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card