TkA01G377350 | RubberDandelionOmics

Gene overview

TkA01G377350

Reference: TK1151 Chr: Chr01 Coordinates: 94137811-94140884 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1355 bp · TkA01G377350|TK1151|cDNA

GACACTTTTCACATCCCTAAGTGAGTGAGAGCTACACTCTATATCTATCACTCTCATTAGGATACCTTTTGCCCCCCCAAATAATTACCATCCCAAATACCCCTTTCCTCATCTTGCTTACATTTTTGGATATTTGAACACAGAAAGATAGGATGTGGATGATGGGTTACAATGAAGCCGAAGACTTGAACATAAACATGATGGAATCCTACGCCAACAATGGCAGTCGGAAGTTAAGACCACTGGTTCCAAGACCCACC...

CDS

Download CDS FASTA

414 bp · TkA01G377350|TK1151|CDS

ATGTGGATGATGGGTTACAATGAAGCCGAAGACTTGAACATAAACATGATGGAATCCTACGCCAACAATGGCAGTCGGAAGTTAAGACCACTGGTTCCAAGACCCACCTGCGCTGCCGCCTCCTCCTCCTCCAACCGCTTCCACTCCACTCACCATGATCATCTACTTCCTCTCAATCATCATCATCATCTTGTGGCAGCTGAACACCACAAGAGAGAGTTTAACTCACAACAAATGGTGGTTGTAAGCTCACGGTGGAA...

Protein

Download Protein FASTA

137 aa · TkA01G377350|TK1151|PROTEIN

MWMMGYNEAEDLNINMMESYANNGSRKLRPLVPRPTCAAASSSSNRFHSTHHDHLLPLNHHHHLVAAEHHKREFNSQQMVVVSSRWNPTPEQLQTLEELYRRGTRTPSADEIQHITAQLRRYGKIERKECFLLVSES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G377350`
TK1151 ID	TkA01G377350
OH-1004 ID	LXL04_003276
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 95.620 / OH-1004 36.695 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G377350

Location Chr01:94137811-94140884 (-)

Description Similar to WOX1: WUSCHEL-related homeobox 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18010`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`At2g01500`	Transcription factor that plays a central role in ovule patterning by regulating cell proliferation of the maternal integuments and differentiation of the megaspore mother cell.	The PRETTY FEW SEEDS2 gene encodes an Arabidopsis homeodomain protein that regulates ovule development.2005 · DOI: 10.1242/dev.01654
`At5g59340`	Probable transcription factor involved in embryonic patterning.	Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.2004 · DOI: 10.1242/dev.00963
`At1g46480`	Promotes differentiation and/or maintenance of the vascular procambium, the initial cells of the developing vasculature.	WOX4 promotes procambial development.2010 · DOI: 10.1104/pp.109.149641 TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.2010 · DOI: 10.1105/tpc.110.076083 WOX4 imparts auxin responsiveness to cambium cells in Arabidopsis.2011 · DOI: 10.1105/tpc.111.087874

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WWU7`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003276 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0007165 signal transduction Biological Process

GO:0009888 tissue development Biological Process

GO:0009908 flower development Biological Process

GO:0009943 adaxial/abaxial axis specification Biological Process

GO:0009947 centrolateral axis specification Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010482 regulation of epidermal cell division Biological Process

GO:0010865 stipule development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT1G46480

ath:AT2G28610

ath:AT3G18010

osa:107275686

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA01G377350 · TK1151

Cytoplasm0.099

Rank 2 · TkA01G377350 · TK1151

Cell membrane0.028

Rank 3 · TkA01G377350 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA01G377350 · TK1151

Plastid0.011

Rank 5 · TkA01G377350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain84-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G377350	`PF00046`	Homeodomain	84	119	2.9e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6X7K0`	Arabidopsis thaliana	sp\|Q6X7K0\|WOX1_ARATH WUSCHEL-related homeobox 1	45.800%	Swiss-Prot	Medium
`Q9ZVF5`	Arabidopsis thaliana	sp\|Q9ZVF5\|WOX6_ARATH WUSCHEL-related homeobox 6	66.000%	Swiss-Prot	Low
`Q6X7K1`	Arabidopsis thaliana	sp\|Q6X7K1\|WOX2_ARATH WUSCHEL-related homeobox 2	63.300%	Swiss-Prot	Low
`Q6X7J9`	Arabidopsis thaliana	sp\|Q6X7J9\|WOX4_ARATH WUSCHEL-related homeobox 4	60.400%	Swiss-Prot	Low
`A2WWU7`	Oryza sativa subsp. indica	sp\|A2WWU7\|WOX5_ORYSI WUSCHEL-related homeobox 5	54.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card