Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2030 bp · TkA01G377010|TK1151|cDNA
CAATTAGTTCATCTTATCAGTTTCACTGTTAAGTTTTTCCGTTAAAGATGATTATATGATTCCTTGGAAATCTTCTGATAGAAATGATAATGTTGGATTAAGATTTATTACGTCTTGACGTTTTCAAGCTCTGATATTGAATTTGGTGATTTTGGAGTAAGGTGTAGGGACTTGTGGAGTGGGAAATGGCAGGGAGTTCAAGTGAGGAGTCTGGAGTTGGCAGGTCACTAGATGGAATGTCAAATGGCCAGCAACTGTCT...
1311 bp · TkA01G377010|TK1151|CDS
ATGGAGTTATCAAAAGTTTTAGATGGATTTGTTGATGCTGACACCCTTAAGATAAAAGCTCAAGTCCAAGTTATCAGGGAAAGAGTAGACCGCCCCTTCAGATGCCTTGACTGTCAGTATAGAAGAGAACTCGTAAGGGTATATTTGTCAAATGTGGAGCAAATATGTCGGCGCTTTGTGGAAGAGAGGAGAGGAAGGCTTGGAAAGTTGATAGAAGATAAAGTTAGGTGGTCAAGCTTCTGTACTTTCTGGTTAGGAAT...
Protein
Download Protein FASTA436 aa · TkA01G377010|TK1151|PROTEIN
MELSKVLDGFVDADTLKIKAQVQVIRERVDRPFRCLDCQYRRELVRVYLSNVEQICRRFVEERRGRLGKLIEDKVRWSSFCTFWLGIDQNARRRMSREKSDLILKVAVKHFFIEKEVTSTLVMDSLYSGLKALEGQSQSQTKNKAKGKCLDTEEVVVPLVPIVRVEKDTFILVDDVLLLLERAALEPLPPKDEKGPQNRTKDGGSGEDFSKDSIERDERRLTELGRRTIEIFVLAHIFSSKIEVAYQEAVALKRQEELIR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G377010 |
|---|---|
| TK1151 ID | TkA01G377010 |
| OH-1004 ID | LXL04_022958 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 77.800 |
| Protein coverage (%) | TK1151 91.514 / OH-1004 43.206Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G377010 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:94056008-94059210 (-) | |||||||||
| Description | Similar to TRAF1B: TNF receptor-associated factor homolog 1b | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0016579 protein deubiquitination Biological Process GO:0031647 regulation of protein stability Biological Process GO:0045087 innate immune response Biological Process GO:0070646 protein modification by small protein removal Biological Process GO:1905037 autophagosome organization Biological Process GO:2000280 regulation of root development Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G04300 ath:AT3G11910 ath:AT3G58210 ath:AT5G06600 ath:AT5G43560 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13373Dsc3_C220-301 aaPF02338OTU228-250 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G377010 | PF13373 | Dsc3_C | 220 | 301 | 0.64 | 10.9 |
| TkA01G377010 | PF02338 | OTU | 228 | 250 | 0.15 | 13.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.