TkA01G374830 | RubberDandelionOmics

Gene overview

TkA01G374830

Reference: TK1151 Chr: Chr01 Coordinates: 93505263-93505737 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA01G374830|TK1151|cDNA

ATGAAGCTCGTAGACACCCTTTTAGAGTTACTATCAGAAGCTCTTGGTCTCGAACCCAACCATCTGAAACAGCAAGAATGTGGGAAGGATCGAACCCTGGTTTGCCACTACTATCCTCCCTGCCCGATACCTGGTCAGACCCTCGGACTAAGCAAGCACACCGATGCTTCTTTCGTCACTCTACTCCTACAAGATGAGGTTGGGGGACTAGAGGTTTTGCATAAAAATCAGTGGGCCAACGTTGAACCTATTCCGGGCGC...

CDS

Download CDS FASTA

348 bp · TkA01G374830|TK1151|CDS

ATGAAGCTCGTAGACACCCTTTTAGAGTTACTATCAGAAGCTCTTGGTCTCGAACCCAACCATCTGAAACAGCAAGAATGTGGGAAGGATCGAACCCTGGTTTGCCACTACTATCCTCCCTGCCCGATACCTGGTCAGACCCTCGGACTAAGCAAGCACACCGATGCTTCTTTCGTCACTCTACTCCTACAAGATGAGGTTGGGGGACTAGAGGTTTTGCATAAAAATCAGTGGGCCAACGTTGAACCTATTCCGGGCGC...

Protein

Download Protein FASTA

115 aa · TkA01G374830|TK1151|PROTEIN

MKLVDTLLELLSEALGLEPNHLKQQECGKDRTLVCHYYPPCPIPGQTLGLSKHTDASFVTLLLQDEVGGLEVLHKNQWANVEPIPGALVINIGDLLQIVSNDKFKSVIQPYTLYT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G374830`
TK1151 ID	TkA01G374830
OH-1004 ID	LXL04_003319
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.900
Protein coverage (%)	TK1151 97.391 / OH-1004 30.518 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G374830

Location Chr01:93505263-93505737 (-)

Description Similar to At1g06620: 1-aminocyclopropane-1-carboxylate oxidase homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03410`	1-aminocyclopropane-1-carboxylate oxidase homolog 5.	No verified direct reference in this release
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At5g59530`	1-aminocyclopropane-1-carboxylate oxidase homolog 11.	No verified direct reference in this release
`At5g43450`	1-aminocyclopropane-1-carboxylate oxidase homolog 10.	No verified direct reference in this release
`At5g43440`	1-aminocyclopropane-1-carboxylate oxidase homolog 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003319 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016629 12-oxophytodienoate reductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03410

ath:AT1G06620

ath:AT1G06640

ath:AT1G06650

ath:AT5G59530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · TkA01G374830 · TK1151

Endoplasmic reticulum0.151

Rank 2 · TkA01G374830 · TK1151

Nucleus0.141

Rank 3 · TkA01G374830 · TK1151

Peroxisome0.105

Rank 4 · TkA01G374830 · TK1151

Lysosome / Vacuole0.069

Rank 5 · TkA01G374830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy30-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G374830	`PF03171`	2OG-FeII_Oxy	30	107	4e-26	92.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43383`	Arabidopsis thaliana	sp\|Q43383\|ACCH5_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 5	64.200%	Swiss-Prot	High
`Q84MB3`	Arabidopsis thaliana	sp\|Q84MB3\|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1	62.600%	Swiss-Prot	High
`Q9LTH8`	Arabidopsis thaliana	sp\|Q9LTH8\|ACH11_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 11	58.900%	Swiss-Prot	High
`Q9LSW6`	Arabidopsis thaliana	sp\|Q9LSW6\|ACH10_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 10	60.700%	Swiss-Prot	High
`Q9LSW7`	Arabidopsis thaliana	sp\|Q9LSW7\|ACCH9_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 9	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card