Gene Card
Gene overview
cDNA / CDS / Protein Sequences
618 bp · TkA01G372030|TK1151|cDNA
ATGGTCATTTTCTTGATCGCTTTTGCTGCTTTACGTCTTTACAAAAAGAAACAAAAGAAGTTTAGCAGAGTGCAAAGCCCTCATGCGATCGTGATTCACCCTCGTAACTCAGGATCCGATAATGAAAGCATAAAAATCACAGTCGTCGGGTCAAGTGTAATTGTGGGTGGACTCAGTAAGACCCACACGATTCCCACAAACGAAGGACACGACATCCAGATGGTGGAGGCGGGCAATATGGTCAAGGAGGTTTTGGGAAA...
618 bp · TkA01G372030|TK1151|CDS
ATGGTCATTTTCTTGATCGCTTTTGCTGCTTTACGTCTTTACAAAAAGAAACAAAAGAAGTTTAGCAGAGTGCAAAGCCCTCATGCGATCGTGATTCACCCTCGTAACTCAGGATCCGATAATGAAAGCATAAAAATCACAGTCGTCGGGTCAAGTGTAATTGTGGGTGGACTCAGTAAGACCCACACGATTCCCACAAACGAAGGACACGACATCCAGATGGTGGAGGCGGGCAATATGGTCAAGGAGGTTTTGGGAAA...
Protein
Download Protein FASTA205 aa · TkA01G372030|TK1151|PROTEIN
MVIFLIAFAALRLYKKKQKKFSRVQSPHAIVIHPRNSGSDNESIKITVVGSSVIVGGLSKTHTIPTNEGHDIQMVEAGNMVKEVLGNGELHDGTKIAVKRMEGGGVIKTFRPNLPRIQWSKLNGATSNVFRDGVFSKGEFPHQSKGLGFKAKKVKGDTARDGFGESVDFVGSYRTPLTSSPTVFQLLSPSLALLAAAFPFQSLIS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G372030 |
|---|---|
| TK1151 ID | TkA01G372030 |
| OH-1004 ID | LXL04_021614 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 93.900 |
| Protein coverage (%) | TK1151 55.610 / OH-1004 48.511Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G372030 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:92793054-92794130 (-) | |||||||||
| Description | Similar to TMK1: Receptor protein kinase TMK1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009555 pollen development Biological Process GO:0010928 regulation of auxin mediated signaling pathway Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009506 plasmodesma Cellular Component GO:0016020 membrane Cellular Component GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G24650 ath:AT1G66150 ath:AT2G01820 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.