TkA01G364380 | RubberDandelionOmics

Gene overview

TkA01G364380

Reference: TK1151 Chr: Chr01 Coordinates: 90721159-90723149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1217 bp · TkA01G364380|TK1151|cDNA

ATTTGTGTACGCTGTAGTCAACTCGTCATCGTCACTCAGCTAGCTATTGTTACAAAAACCAAAGTACCAAACAGTCAAGCCTCCAAAACAATAAAGTAGATCAATGGGTGCTTCTAGCCCACCAATTTCCCATCTTCTTCCCAACCCCAACAAAACCCTAATCGCCAAGAACAAAAGGAAGCCGTTCTTCATCGTCGTCTCTTCATCTTCTAAATCCCAATTAGTATTACAAAGAAGGCAGTTACTGTTGCTTTCTGTTC...

CDS

Download CDS FASTA

684 bp · TkA01G364380|TK1151|CDS

ATGGGTGCTTCTAGCCCACCAATTTCCCATCTTCTTCCCAACCCCAACAAAACCCTAATCGCCAAGAACAAAAGGAAGCCGTTCTTCATCGTCGTCTCTTCATCTTCTAAATCCCAATTAGTATTACAAAGAAGGCAGTTACTGTTGCTTTCTGTTCCAATTTCAATCACAACGATTCAACTGAGTTCTTGCCCGGGTTCAGCTGTTGCAGCGTCTGTTTTCGACCCGATTACGGATGCCGAGAGAGCTGCGAGCTCGGA...

Protein

Download Protein FASTA

227 aa · TkA01G364380|TK1151|PROTEIN

MGASSPPISHLLPNPNKTLIAKNKRKPFFIVVSSSSKSQLVLQRRQLLLLSVPISITTIQLSSCPGSAVAASVFDPITDAERAASSEVSRRVTEAVELLEKGREFQAQGDYVQALKYFTQVVREYKDFALSEYARVGRALALYEVGDKNEAISEMEDVSISLKGSPEVHAALAAALYSDKHAPVLAENQFTIATLLDPKYTDLGYVKYTKHWPPSLVQSLQDFITLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G364380`
TK1151 ID	TkA01G364380
OH-1004 ID	LXL04_003403
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G364380`
Location	Chr01:90721159-90723149 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003403` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · TkA01G364380 · TK1151

Mitochondrion0.021

Rank 2 · TkA01G364380 · TK1151

Nucleus0.016

Rank 3 · TkA01G364380 · TK1151

Cytoplasm0.012

Rank 4 · TkA01G364380 · TK1151

Cell membrane0.009

Rank 5 · TkA01G364380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13428TPR_1483-103 aa

PF07719TPR_286-102 aa

PF13176TPR_790-101 aa

PF14559TPR_1992-101 aa

PF04212MIT92-128 aa

PF13428TPR_1497-128 aa

PF07719TPR_298-127 aa

PF00515TPR_198-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G364380	`PF13428`	TPR_14	83	103	0.0026	19.0
TkA01G364380	`PF07719`	TPR_2	86	102	5.1e-05	23.8
TkA01G364380	`PF13176`	TPR_7	90	101	0.039	14.8
TkA01G364380	`PF14559`	TPR_19	92	101	1e-06	29.7
TkA01G364380	`PF04212`	MIT	92	128	0.15	12.9
TkA01G364380	`PF13428`	TPR_14	97	128	0.0026	19.0
TkA01G364380	`PF07719`	TPR_2	98	127	5.1e-05	23.8
TkA01G364380	`PF00515`	TPR_1	98	123	0.00045	20.6
TkA01G364380	`PF13432`	TPR_16	99	154	4.2e-05	24.6
TkA01G364380	`PF13181`	TPR_8	100	123	0.17	12.9
TkA01G364380	`PF24575`	TPR_Slam	102	130	0.017	16.2
TkA01G364380	`PF13174`	TPR_6	105	126	0.0015	19.7
TkA01G364380	`PF13176`	TPR_7	105	126	0.039	14.8
TkA01G364380	`PF13424`	TPR_12	106	152	0.53	11.2
TkA01G364380	`PF14559`	TPR_19	107	174	1e-06	29.7
TkA01G364380	`PF31234`	TPR_Psidin_N	108	202	0.22	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card