RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G363290
Reference: TK1151 Chr: Chr01 Coordinates: 90419345-90423506 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1646 bp · TkA01G363290|TK1151|cDNA

GAGGTGTATTTTGTCCGCATTTTGACTATAATTTCAAATGCAAACAGCTTGACTTCTGTAACCTACGCTTCTCCGTTTCGCTTATATGTATACTTCACAAAGACCACGACTTTTCATGCCTCGACCTCTCTCTCTAAATTTACGCGCGAAGAAAAGATGAAGAACAACCGAGGCGGAGGGGGAAAAGTATCACCTAAATGGATTATCATTTTCAGCATCTTCAGTTTCGTACTTGGCATGCTTTTTACAAACAGGGTGTG...

CDS

Download CDS FASTA

1374 bp · TkA01G363290|TK1151|CDS

GAGGTGTATTTTGTCCGCATTTTGACTATAATTTCAAATGCAAACAGCTTGACTTCTGTAACCTACGCTTCTCCGTTTCGCTTATATGTATACTTCACAAAGACCACGACTTTTCATGCCTCGACCTCTCTCTCTAAATTTACGCGCGAAGAAAAGATGAAGAACAACCGAGGCGGAGGGGGAAAAGTATCACCTAAATGGATTATCATTTTCAGCATCTTCAGTTTCGTACTTGGCATGCTTTTTACAAACAGGGTGTG...

Protein

Download Protein FASTA

457 aa · TkA01G363290|TK1151|PROTEIN

EVYFVRILTIISNANSLTSVTYASPFRLYVYFTKTTTFHASTSLSKFTREEKMKNNRGGGGKVSPKWIIIFSIFSFVLGMLFTNRVWAPIESDGRIMRRKEQEMKIVTDDCITNKDNDLMGEVHKTQEAIQSLENSISELRLELPHNQSSFEEVKDDNLHSNKTNEDKSGRRKKAFMVIGINTAFSSRRRRDSIRETWMPRGEKLLQLEKEKGIVVRFMIGHSATSKSILDRAIDSEEAQHKDFFRLEHVEGYHELTAKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G363290
TK1151 IDTkA01G363290
OH-1004 IDLXL04_022845
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)80.700
Protein coverage (%)TK1151 85.777 / OH-1004 95.157
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G363290
LocationChr01:90419345-90423506 (-)
DescriptionSimilar to B3GALT7: Beta-1,3-galactosyltransferase 7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g77810 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.
Identification of a novel group of putative Arabidopsis thaliana beta-(1,3)-galactosyltransferases.2008 · DOI: 10.1007/s11103-008-9351-3
At1g22015 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release
At1g05170 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release
At1g33430 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release
At1g32930 Beta-galactosyltransferase involved in elongation of beta-1,6-linked galactan side chains on arabinogalactan proteins.
A galactosyltransferase acting on arabinogalactan protein glycans is essential for embryo development in Arabidopsis.2013 · DOI: 10.1111/tpj.12281
Galactosyltransferases from Arabidopsis thaliana in the biosynthesis of type II arabinogalactan: molecular interaction enhances enzyme activity.2014 · DOI: 10.1186/1471-2229-14-90

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022845 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009101 glycoprotein biosynthetic process Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010208 pollen wall assembly Biological Process
GO:0010407 non-classical arabinogalactan protein metabolic process Biological Process
GO:0010584 pollen exine formation Biological Process
GO:0030244 cellulose biosynthetic process Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0008378 galactosyltransferase activity Molecular Function
GO:0048531 beta-1,3-galactosyltransferase activity Molecular Function
KEGG gene cross-reference
ath:AT1G05170
ath:AT1G22015
ath:AT1G32930
ath:AT1G33430
ath:AT1G77810
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.816
Rank 1 · TkA01G363290 · TK1151
Endoplasmic reticulum0.082
Rank 2 · TkA01G363290 · TK1151
Cell membrane0.065
Rank 3 · TkA01G363290 · TK1151
Cytoplasm0.056
Rank 4 · TkA01G363290 · TK1151
Extracellular0.046
Rank 5 · TkA01G363290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13334DUF409464-149 aa
PF02434Fringe88-112 aa
PF30757CCDC12598-153 aa
PF19745FUT8_N_cat102-260 aa
PF15770DUF4699112-146 aa
PF13339AATF-Che1114-169 aa
PF30081MAL13P1_147_C126-163 aa
PF15770DUF4699152-197 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G363290PF13334DUF4094641491.3e-2384.0
TkA01G363290PF02434Fringe881120.0001421.9
TkA01G363290PF30757CCDC125981530.0514.4
TkA01G363290PF19745FUT8_N_cat1022600.02514.1
TkA01G363290PF15770DUF46991121460.02214.8
TkA01G363290PF13339AATF-Che11141690.05714.7
TkA01G363290PF30081MAL13P1_147_C1261630.1313.1
TkA01G363290PF15770DUF46991521970.02214.8
TkA01G363290PF30355zf_C2H2-Disco1781930.0414.7
TkA01G363290PF01762Galactosyl_T1893869.5e-48163.3
TkA01G363290PF02434Fringe2553420.0001421.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q6NQB7Arabidopsis thalianasp|Q6NQB7|B3GT7_ARATH Beta-1,3-galactosyltransferase 766.300%Swiss-ProtHigh
Q9LM60Arabidopsis thalianasp|Q9LM60|B3GT5_ARATH Probable beta-1,3-galactosyltransferase 560.800%Swiss-ProtHigh
A8MRC7Arabidopsis thalianasp|A8MRC7|B3GT2_ARATH Probable beta-1,3-galactosyltransferase 258.500%Swiss-ProtHigh
Q9C809Arabidopsis thalianasp|Q9C809|B3GT8_ARATH Probable beta-1,3-galactosyltransferase 859.800%Swiss-ProtHigh
Q9MAP8Arabidopsis thalianasp|Q9MAP8|B3GT6_ARATH Beta-1,6-galactosyltransferase GALT31A59.000%Swiss-ProtHigh

JBrowse

View in Genome Browser