TkA01G359480 | RubberDandelionOmics

Gene overview

TkA01G359480

Reference: TK1151 Chr: Chr01 Coordinates: 89340334-89341822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1046 bp · TkA01G359480|TK1151|cDNA

TGAGCACAAGATTTAGCCCAACTAGGCTTTGTACGACATAAAGCCCAAAGAGCCGCCCATTAGGGTTTCAGCAGTTCCACACCGCCGGAGCAAGCGAAGCATCAGAAGGTCATCCATCAATGGCGCCAAAGCAGAGAACTCCTCATACATCCCGGAACCCAGATCTCATCAGGGGTGTCGGGAAATACTCCCGCTCTCAGATGTACCACAAGAGAGGACTCTGGGCCATTAAAGCCAAGAACGGTGGCACTTTCCCCACC...

CDS

Download CDS FASTA

702 bp · TkA01G359480|TK1151|CDS

ATGGCGCCAAAGCAGAGAACTCCTCATACATCCCGGAACCCAGATCTCATCAGGGGTGTCGGGAAATACTCCCGCTCTCAGATGTACCACAAGAGAGGACTCTGGGCCATTAAAGCCAAGAACGGTGGCACTTTCCCCACCCACGCGAAGAAGCCCGCCGACGCTCCCGTCGCCGCCAAGCCCCCGAAGTTTTACCCCGCCGACGATGTCAAGAAACCCCTTGTCAACAAGCGCAAAGCCAGGCCCACTAAGCTCAGGGC...

Protein

Download Protein FASTA

233 aa · TkA01G359480|TK1151|PROTEIN

MAPKQRTPHTSRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGTFPTHAKKPADAPVAAKPPKFYPADDVKKPLVNKRKARPTKLRASITPGTVLIIMAGRFKGKRVVFLKQLTSGLLLVTGPFKVNGVPLRRVNQSYVIATSTKVDIAGLNVEKFDDKYFSKKVEKKKKKGEGEFFEAEKEEKSLLPQEKKDDQKTVDAALIKSIEAVPELKSYLGARFSLKAGMKPHELVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G359480`
TK1151 ID	TkA01G359480
OH-1004 ID	LXL04_003441
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G359480

Location Chr01:89340334-89341822 (-)

Description Similar to RPL6: 60S ribosomal protein L6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74050`	Large ribosomal subunit protein eL6x.	No verified direct reference in this release
`At1g18540`	Large ribosomal subunit protein eL6z.	No verified direct reference in this release
`At1g74060`	Large ribosomal subunit protein eL6y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003441 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0015934 large ribosomal subunit Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G18540

ath:AT1G74050

ath:AT1G74060

ssc:733592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.901

Rank 1 · TkA01G359480 · TK1151

Nucleus0.216

Rank 2 · TkA01G359480 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkA01G359480 · TK1151

Mitochondrion0.019

Rank 4 · TkA01G359480 · TK1151

Cell membrane0.014

Rank 5 · TkA01G359480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03868Ribosomal_L6e_N3-52 aa

PF01777Ribosomal_L27e94-116 aa

PF01159Ribosomal_L6e126-233 aa

PF01777Ribosomal_L27e132-168 aa

PF03868Ribosomal_L6e_N163-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G359480	`PF03868`	Ribosomal_L6e_N	3	52	2e-17	63.8
TkA01G359480	`PF01777`	Ribosomal_L27e	94	116	0.0084	16.8
TkA01G359480	`PF01159`	Ribosomal_L6e	126	233	5e-41	140.4
TkA01G359480	`PF01777`	Ribosomal_L27e	132	168	0.0084	16.8
TkA01G359480	`PF03868`	Ribosomal_L6e_N	163	171	2e-17	63.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C5`	Arabidopsis thaliana	sp\|Q9C9C5\|RL63_ARATH Large ribosomal subunit protein eL6x	82.500%	Swiss-Prot	High
`Q9FZ76`	Arabidopsis thaliana	sp\|Q9FZ76\|RL61_ARATH Large ribosomal subunit protein eL6z	81.600%	Swiss-Prot	High
`Q9C9C6`	Arabidopsis thaliana	sp\|Q9C9C6\|RL62_ARATH Large ribosomal subunit protein eL6y	81.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card