TkA01G348870 | RubberDandelionOmics

Gene overview

TkA01G348870

Reference: TK1151 Chr: Chr01 Coordinates: 86629675-86630374 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA01G348870|TK1151|cDNA

ATGCTGGTGCGCGAGACTGCAGCGCGACAACTGGAGAGGCGAGCCGACTGGGGCTACTCGAAAACCAGTTGTTGCCCTAGACATGACATGGAACCTCGCCTCCGTAGCGGTTTCGGTGGTTTTGTTGATTTGCACGTGGAGGAGAAACCGAACGTGCGATTAGGGTTTGGATCTGCGGATATGCTTTGCATGTGCGGTGCATGCGGTGCTGGTGTGGTGGAATATAGTCGGAGAAGTCGAAGATTACATGAAGAAGAAAC...

CDS

Download CDS FASTA

399 bp · TkA01G348870|TK1151|CDS

ATGCTGGTGCGCGAGACTGCAGCGCGACAACTGGAGAGGCGAGCCGACTGGGGCTACTCGAAAACCAGTTGTTGCCCTAGACATGACATGGAACCTCGCCTCCGTAGCGGTTTCGGTGGTTTTGTTGATTTGCACGTGGAGGAGAAACCGAACGTGCGATTAGGGTTTGGATCTGCGGATATGCTTTGCATGTGCGGTGCATGCGGTGCTGGTGTGGTGGAATATAGTCGGAGAAGTCGAAGATTACATGAAGAAGAAAC...

Protein

Download Protein FASTA

132 aa · TkA01G348870|TK1151|PROTEIN

MLVRETAARQLERRADWGYSKTSCCPRHDMEPRLRSGFGGFVDLHVEEKPNVRLGFGSADMLCMCGACGAGVVEYSRRSRRLHEEETTGGSESNYNDSEDDDGRIGAFLTSNSISLPQDVRILIRWYHLSGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G348870`
TK1151 ID	TkA01G348870
OH-1004 ID	LXL04_003511
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.300
Protein coverage (%)	TK1151 74.242 / OH-1004 14.126 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G348870`
Location	Chr01:86629675-86630374 (+)
Description	Similar to RIE1: E3 ubiquitin protein ligase RIE1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003511` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0016180 snRNA processing Biological Process GO:0016567 protein ubiquitination Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0004521 RNA endonuclease activity Molecular Function GO:0004842 ubiquitin-protein transferase activity Molecular Function
KEGG gene cross-reference	ath:AT1G12760 ath:AT1G63170 ath:AT2G01730 ath:AT2G01735 ath:AT4G11680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.401

Rank 1 · TkA01G348870 · TK1151

Cytoplasm0.387

Rank 2 · TkA01G348870 · TK1151

Mitochondrion0.154

Rank 3 · TkA01G348870 · TK1151

Cell membrane0.136

Rank 4 · TkA01G348870 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA01G348870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22104MHV_Nsp3_DPUP100-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G348870	`PF22104`	MHV_Nsp3_DPUP	100	131	0.34	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card