TkA01G333370 | RubberDandelionOmics

Gene overview

TkA01G333370

Reference: TK1151 Chr: Chr01 Coordinates: 82854756-82860072 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

833 bp · TkA01G333370|TK1151|cDNA

GGCAAAAGGTACAACTGCTACGTCGAGCTCGCCGAAGCAGCATTAGGAAACCGATTGGGTGCATGGTTGTCGCTGTTTCCGACAGCTTACTTATCTGCAGGGACGGCGACGGCGCTGATTATCGTCGGAGGGGAAACCATGAAGCTCTTCTTTGAAATCGTTTGTGGGCCTCTTTGTTCGTTTAATCCATTAACCACGGTGGAATGGTATCTGGTTTTCACGTCGTTATGCATCGTGCTGTCTCAGCTTCCGAACCTCAA...

CDS

Download CDS FASTA

780 bp · TkA01G333370|TK1151|CDS

GGCAAAAGGTACAACTGCTACGTCGAGCTCGCCGAAGCAGCATTAGGAAACCGATTGGGTGCATGGTTGTCGCTGTTTCCGACAGCTTACTTATCTGCAGGGACGGCGACGGCGCTGATTATCGTCGGAGGGGAAACCATGAAGCTCTTCTTTGAAATCGTTTGTGGGCCTCTTTGTTCGTTTAATCCATTAACCACGGTGGAATGGTATCTGGTTTTCACGTCGTTATGCATCGTGCTGTCTCAGCTTCCGAACCTCAA...

Protein

Download Protein FASTA

259 aa · TkA01G333370|TK1151|PROTEIN

GKRYNCYVELAEAALGNRLGAWLSLFPTAYLSAGTATALIIVGGETMKLFFEIVCGPLCSFNPLTTVEWYLVFTSLCIVLSQLPNLNSIAGLSLVGAVTAIIYSTMVWLLSVSQPRPPNISYEPLALPTFTSSIFSVFNALGIIAFAFRGHNLVLEIQSTMSSTFKHPAHVPMWRGAKVAYFFIAMCLFPVAIGGFWAYGNLELHENNSMCCKHNYDTIVQLASVGISISIFGGLCLWLSSILGRLVQGRRRSAAAEFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G333370`
TK1151 ID	TkA01G333370
OH-1004 ID	LXL04_031629
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.100
Protein coverage (%)	TK1151 90.734 / OH-1004 45.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G333370

Location Chr01:82854756-82860072 (+)

Description Similar to AATL1: Lysine histidine transporter-like 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47670`	Amino acid transporter.	No verified direct reference in this release
`At4g35180`	Amino acid transporter.	No verified direct reference in this release
`At1g24400`	Amino acid-proton symporter.	Selective expression of a novel high-affinity transport system for acidic and neutral amino acids in the tapetum cells of Arabidopsis flowers.2004 · DOI: 10.1111/j.1365-313x.2004.02186.x
`At1g25530`	Amino acid transporter.	No verified direct reference in this release
`At5g40780`	Amino acid-proton symporter.	Arabidopsis LHT1 is a high-affinity transporter for cellular amino acid uptake in both root epidermis and leaf mesophyll.2006 · DOI: 10.1105/tpc.106.041012 Comprehensive screening of Arabidopsis mutants suggests the lysine histidine transporter 1 to be involved in plant uptake of amino acids.2007 · DOI: 10.1104/pp.106.092205 Root uptake of cationic amino acids by Arabidopsis depends on functional expression of amino acid permease 5.2008 · DOI: 10.1111/j.1469-8137.2008.02589.x LHT1, a lysine- and histidine-specific amino acid transporter in arabidopsis.1997 · DOI: 10.1104/pp.115.3.1127

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031629 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006952 defense response Biological Process

GO:0043090 amino acid import Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015172 acidic amino acid transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G24400

ath:AT1G47670

ath:AT1G48640

ath:AT4G35180

ath:AT5G40780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.557

Rank 1 · TkA01G333370 · TK1151

Lysosome / Vacuole0.198

Rank 2 · TkA01G333370 · TK1151

Endoplasmic reticulum0.147

Rank 3 · TkA01G333370 · TK1151

Cytoplasm0.094

Rank 4 · TkA01G333370 · TK1151

Golgi apparatus0.066

Rank 5 · TkA01G333370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans2-234 aa

PF25842NfeD_TM30-110 aa

PF02453Reticulon63-140 aa

PF25842NfeD_TM128-148 aa

PF25842NfeD_TM231-244 aa

PF02453Reticulon234-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G333370	`PF01490`	Aa_trans	2	234	1.7e-28	100.1
TkA01G333370	`PF25842`	NfeD_TM	30	110	9.9	7.6
TkA01G333370	`PF02453`	Reticulon	63	140	0.25	11.9
TkA01G333370	`PF25842`	NfeD_TM	128	148	9.9	7.6
TkA01G333370	`PF25842`	NfeD_TM	231	244	9.9	7.6
TkA01G333370	`PF02453`	Reticulon	234	248	0.25	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX98`	Arabidopsis thaliana	sp\|Q9SX98\|LHTL8_ARATH Lysine histidine transporter-like 8	83.300%	Swiss-Prot	High
`Q84WE9`	Arabidopsis thaliana	sp\|Q84WE9\|LHTL7_ARATH Lysine histidine transporter-like 7	41.000%	Swiss-Prot	Medium
`Q9LRB5`	Arabidopsis thaliana	sp\|Q9LRB5\|LHT2_ARATH Lysine histidine transporter 2	40.400%	Swiss-Prot	Medium
`Q9C6M2`	Arabidopsis thaliana	sp\|Q9C6M2\|LHTL6_ARATH Lysine histidine transporter-like 6	40.900%	Swiss-Prot	Medium
`Q9FKS8`	Arabidopsis thaliana	sp\|Q9FKS8\|LHT1_ARATH Lysine histidine transporter 1	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card