RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G322540
Reference: TK1151 Chr: Chr01 Coordinates: 80203982-80208056 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2752 bp · TkA01G322540|TK1151|cDNA

CCTTAATCATCTACACTACTGACTGCAGAATCACCCATTATACTTCCAGATTTCTCCAAAAAAAACTTGAGGAAGGCAGACGGTAGTCAACTACATGGATTCCTTCGGCGGCTCATACTTCACCGACGAGAAAGCAGCGAAGGTCGAGAATATCTTCTTGGAGTTCCTTAAAAGTTTTAGATTAGATGCGCATTCAAGAGAACCTTTCTACGAGTCAGAAATCGAAGCAATGAGACCAAATGAGTCCAACACCATGTTTA...

CDS

Download CDS FASTA

2439 bp · TkA01G322540|TK1151|CDS

ATGGATTCCTTCGGCGGCTCATACTTCACCGACGAGAAAGCAGCGAAGGTCGAGAATATCTTCTTGGAGTTCCTTAAAAGTTTTAGATTAGATGCGCATTCAAGAGAACCTTTCTACGAGTCAGAAATCGAAGCAATGAGACCAAATGAGTCCAACACCATGTTTATTGATTTCTCTCATGTTATGAGGTTCAGCGATATTCTACAGAAGGCCATATCTGATGAATATCTGAGGTTTGAGTCGTACCTGAAGAACGCATG...

Protein

Download Protein FASTA

812 aa · TkA01G322540|TK1151|PROTEIN

MDSFGGSYFTDEKAAKVENIFLEFLKSFRLDAHSREPFYESEIEAMRPNESNTMFIDFSHVMRFSDILQKAISDEYLRFESYLKNACKRFVMGQKPTFITDDNPNKDINIAFYNLPVIKRLRELSTSEIGRLVSVTGVVTRTSEVRPELLQGTFKCLECGTIVKNVEQQYKYTEPMICINAMCAKKGSWTLLRQESKFADWQRVRMQETSKEIPAGSLPRSLDVILRHDIVEQARAGDTVIFTGTVVVIPDIFALSAPGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G322540
TK1151 IDTkA01G322540
OH-1004 IDLXL04_003562
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G322540
LocationChr01:80203982-80208056 (-)
DescriptionSimilar to MCM6: DNA replication licensing factor MCM6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g44635 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0235800 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
UniProt: B8AZX3 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_003562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0000727 double-strand break repair via break-induced replication Biological Process
GO:0006270 DNA replication initiation Biological Process
GO:0006279 premeiotic DNA replication Biological Process
GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process
GO:0044786 cell cycle DNA replication Biological Process
GO:1902969 mitotic DNA replication Biological Process
GO:1902975 mitotic DNA replication initiation Biological Process
GO:0000347 THO complex Cellular Component
GO:0000785 chromatin Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005656 nuclear pre-replicative complex Cellular Component
KEGG gene cross-reference
ath:AT5G44635
dosa:Os05g0235800
spo:2540784
xtr:548975
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.926
Rank 1 · TkA01G322540 · TK1151
Cytoplasm0.139
Rank 2 · TkA01G322540 · TK1151
Mitochondrion0.035
Rank 3 · TkA01G322540 · TK1151
Cell membrane0.019
Rank 4 · TkA01G322540 · TK1151
Endoplasmic reticulum0.008
Rank 5 · TkA01G322540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551MCM_N19-114 aa
PF20776SLS1_N40-53 aa
PF17207MCM_OB121-249 aa
PF04546Sigma70_ner319-356 aa
PF00493MCM335-557 aa
PF01078Mg_chelatase388-416 aa
PF07728AAA_5392-510 aa
PF07726AAA_3430-507 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G322540PF14551MCM_N191141.5e-1351.7
TkA01G322540PF20776SLS1_N40530.213.0
TkA01G322540PF17207MCM_OB1212492.2e-41141.2
TkA01G322540PF04546Sigma70_ner3193560.0614.0
TkA01G322540PF00493MCM3355572.6e-101338.1
TkA01G322540PF01078Mg_chelatase3884167.9e-0729.4
TkA01G322540PF07728AAA_53925100.001119.6
TkA01G322540PF07726AAA_34305070.004517.6
TkA01G322540PF01078Mg_chelatase4445117.9e-0729.4
TkA01G322540PF00158Sigma54_activat4465050.01116.1
TkA01G322540PF20776SLS1_N5595880.213.0
TkA01G322540PF17855MCM_lid5726562.6e-2486.2
TkA01G322540PF04546Sigma70_ner6756990.0614.0
TkA01G322540PF18263WHD_MCM66988112.5e-2176.5
TkA01G322540PF04546Sigma70_ner7127650.0614.0
TkA01G322540PF07728AAA_57337860.001119.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4KAB8Arabidopsis thalianasp|F4KAB8|MCM6_ARATH DNA replication licensing factor MCM672.500%Swiss-ProtHigh
Q6F353Oryza sativa subsp. japonicasp|Q6F353|MCM6_ORYSJ DNA replication licensing factor MCM673.300%Swiss-ProtHigh
B8AZX3Oryza sativa subsp. indicasp|B8AZX3|MCM6_ORYSI DNA replication licensing factor MCM673.200%Swiss-ProtHigh

JBrowse

View in Genome Browser