TkA01G322060 | RubberDandelionOmics

Gene overview

TkA01G322060

Reference: TK1151 Chr: Chr01 Coordinates: 80085318-80093917 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2122 bp · TkA01G322060|TK1151|cDNA

TTTATGTGCCGCGAACACAAAAAGACATCGCTCAAGATATCAAGATTAACGTTCTAAACGTGTAGATTTTTATGATTCAACAAGAACAGTTAATGGAATTGGTATTCAATCTGAGTCGAATCCAATTTTAACCCATTGATTTTGCTGTTGTAATCCGAATTCTTTGAGATTACAATCCATCTAGAAATTGCAACTTTTAACCCATTTGAGCCGATGTTAGCAGCAGCCTGCGCCGCCGCCGTATGCTTTCCGCGTCTAAC...

CDS

Download CDS FASTA

1308 bp · TkA01G322060|TK1151|CDS

ATGTCGAATTTCCTTTTCGGTTTTCATATCGGTGTAATGAATGGCCCTATTGTATCTATTGCCAAAGAGCTAGGGTTTGAAGGCAACTCAATACTTGAGGGGCTAGTTGTGAGCATCTTCATTGCAGGTGCTTTTCTGGGAAGTGCAGGCGCTGGTTACCTGGTTGATAGACTTGGGTTCAAAAAAACCCTTCAAGTTGACACAATACCTCTAATTCTTGGTGCCATTTTAAGTGCCCAAGCCCACTCTTTGGATCAGTT...

Protein

Download Protein FASTA

435 aa · TkA01G322060|TK1151|PROTEIN

MSNFLFGFHIGVMNGPIVSIAKELGFEGNSILEGLVVSIFIAGAFLGSAGAGYLVDRLGFKKTLQVDTIPLILGAILSAQAHSLDQLLWGRFFVGLGIGANAVLVPIYISEVAPTKYRGTLGSLCQIGTCTGIIASLFLGIFSENDPHWWRTMLYIASVPGFILAFGMQFAVESPRWLCKAGRLDDAKEVIINLWGPSEVDKSIQEFQSVLNNDGGDLESRWSELLEEPHSKVAFIGGTLFILQQFAGINAVLYFSSLTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G322060`
TK1151 ID	TkA01G322060
OH-1004 ID	LXL04_001864
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 81.308 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G322060

Location Chr01:80085318-80093917 (-)

Description Similar to At1g05030: Probable plastidic glucose transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05030`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release
`At5g16150`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release
`At1g67300`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release
`At1g79820`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001864 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0015749 monosaccharide transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G05030

ath:AT1G67300

ath:AT1G79820

ath:AT5G16150

sep:SE_0247

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.365

Rank 1 · TkA01G322060 · TK1151

Cell membrane0.222

Rank 2 · TkA01G322060 · TK1151

Endoplasmic reticulum0.166

Rank 3 · TkA01G322060 · TK1151

Cytoplasm0.137

Rank 4 · TkA01G322060 · TK1151

Golgi apparatus0.114

Rank 5 · TkA01G322060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr2-427 aa

PF07690MFS_13-373 aa

PF17314DUF5360126-165 aa

PF12854PPR_1178-190 aa

PF07690MFS_1288-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G322060	`PF00083`	Sugar_tr	2	427	1.9e-102	344.2
TkA01G322060	`PF07690`	MFS_1	3	373	1e-24	87.8
TkA01G322060	`PF17314`	DUF5360	126	165	0.16	12.7
TkA01G322060	`PF12854`	PPR_1	178	190	0.056	13.9
TkA01G322060	`PF07690`	MFS_1	288	422	1e-24	87.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WVE9`	Arabidopsis thaliana	sp\|Q0WVE9\|PLST1_ARATH Probable plastidic glucose transporter 1	76.100%	Swiss-Prot	High
`Q56ZZ7`	Arabidopsis thaliana	sp\|Q56ZZ7\|PLST4_ARATH Plastidic glucose transporter 4	42.700%	Swiss-Prot	Medium
`Q9FYG3`	Arabidopsis thaliana	sp\|Q9FYG3\|PLST2_ARATH Probable plastidic glucose transporter 2	44.700%	Swiss-Prot	Medium
`Q2V4B9`	Arabidopsis thaliana	sp\|Q2V4B9\|PLST3_ARATH Probable plastidic glucose transporter 3	43.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card