TkA01G321000 | RubberDandelionOmics

Gene overview

TkA01G321000

Reference: TK1151 Chr: Chr01 Coordinates: 79739773-79740075 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA01G321000|TK1151|cDNA

ATGATCTTTGTTTCTTGCAGGTTGCTTTTCCGCACTGTGCAACATGCTTTGGTCGCTGCTACCCCTGGTGGAGCTGCTCTGATCACAGATGGTAAGAACTTGTTTGAGGGAATTAACCGCCTATTAGCAACCTCACCCTCTAGAGAACTACCAAAACCTATTCATAATGCCGAGCCCAAGAACGTTTCAGTGAATGGTAATCTGCCTGTGGTCGAAAACGGGGTCATGCATGACATTGAAAGAACCACTAGTGCTGGTCT...

CDS

Download CDS FASTA

303 bp · TkA01G321000|TK1151|CDS

ATGATCTTTGTTTCTTGCAGGTTGCTTTTCCGCACTGTGCAACATGCTTTGGTCGCTGCTACCCCTGGTGGAGCTGCTCTGATCACAGATGGTAAGAACTTGTTTGAGGGAATTAACCGCCTATTAGCAACCTCACCCTCTAGAGAACTACCAAAACCTATTCATAATGCCGAGCCCAAGAACGTTTCAGTGAATGGTAATCTGCCTGTGGTCGAAAACGGGGTCATGCATGACATTGAAAGAACCACTAGTGCTGGTCT...

Protein

Download Protein FASTA

100 aa · TkA01G321000|TK1151|PROTEIN

MIFVSCRLLFRTVQHALVAATPGGAALITDGKNLFEGINRLLATSPSRELPKPIHNAEPKNVSVNGNLPVVENGVMHDIERTTSAGLGRTNRIQLVQKRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G321000`
TK1151 ID	TkA01G321000
OH-1004 ID	LXL04_009621
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.800
Protein coverage (%)	TK1151 57.000 / OH-1004 9.773 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G321000`
Location	Chr01:79739773-79740075 (+)
Description	Similar to COG8: Conserved oligomeric Golgi complex subunit 8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009621` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process GO:0006891 intra-Golgi vesicle-mediated transport Biological Process GO:0007030 Golgi organization Biological Process GO:0007290 spermatid nucleus elongation Biological Process GO:0009860 pollen tube growth Biological Process GO:0015031 protein transport Biological Process GO:0048193 Golgi vesicle transport Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0016020 membrane Cellular Component GO:0017119 Golgi transport complex Cellular Component
KEGG gene cross-reference	ath:AT5G11980 bta:768007 dme:Dmel_CG6488 hsa:84342 mmu:97484 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.346

Rank 1 · TkA01G321000 · TK1151

Nucleus0.305

Rank 2 · TkA01G321000 · TK1151

Mitochondrion0.244

Rank 3 · TkA01G321000 · TK1151

Cell membrane0.107

Rank 4 · TkA01G321000 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA01G321000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05456eIF_4EBP16-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G321000	`PF05456`	eIF_4EBP	16	60	0.047	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card