TkA01G320320 | RubberDandelionOmics

Gene overview

TkA01G320320

Reference: TK1151 Chr: Chr01 Coordinates: 79525424-79526422 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

597 bp · TkA01G320320|TK1151|cDNA

GCATCTGGAATCGCCGCCATTGACGTAAAGAAGCTGAAAGACGCAGGTCTATGTACAGTTGAATCCGTAGCTTACTCTCCACGAAAAGAGCTTCTCCAAATCAAAGGAATAAGTGAAGCTAAAGTCGACAAAATCATTGAAGCAGCTTCCAAGTTGGTCCCTTTGGGTTTCACTAGCGCTGGTCAACTCCATCAACAAAGACTTGAAATAATCCAAATATCTTCAGGGTCAAGAGAACTTGACAAGATATTATATGGTGG...

CDS

Download CDS FASTA

597 bp · TkA01G320320|TK1151|CDS

GCATCTGGAATCGCCGCCATTGACGTAAAGAAGCTGAAAGACGCAGGTCTATGTACAGTTGAATCCGTAGCTTACTCTCCACGAAAAGAGCTTCTCCAAATCAAAGGAATAAGTGAAGCTAAAGTCGACAAAATCATTGAAGCAGCTTCCAAGTTGGTCCCTTTGGGTTTCACTAGCGCTGGTCAACTCCATCAACAAAGACTTGAAATAATCCAAATATCTTCAGGGTCAAGAGAACTTGACAAGATATTATATGGTGG...

Protein

Download Protein FASTA

198 aa · TkA01G320320|TK1151|PROTEIN

ASGIAAIDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAASKLVPLGFTSAGQLHQQRLEIIQISSGSRELDKILYGGIETGSITKLYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGNDVLENVAYARAYNTDHQSRLLLEAASMMVETRFFSFLHFFNKII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G320320`
TK1151 ID	TkA01G320320
OH-1004 ID	LXL04_018563
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 94.444 / OH-1004 53.736 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G320320

Location Chr01:79525424-79526422 (-)

Description Similar to RAD51: DNA repair protein RAD51 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20850`	Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity.	The Arabidopsis AtRAD51 gene is dispensable for vegetative development but required for meiosis.2004 · DOI: 10.1073/pnas.0404110101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000730 DNA recombinase assembly Biological Process

GO:0006259 DNA metabolic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0009314 response to radiation Biological Process

KEGG gene cross-reference

ath:AT5G20850

hsa:5888

sly:544003

zma:541709

zma:541710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.471

Rank 1 · TkA01G320320 · TK1151

Cytoplasm0.354

Rank 2 · TkA01G320320 · TK1151

Mitochondrion0.146

Rank 3 · TkA01G320320 · TK1151

Peroxisome0.042

Rank 4 · TkA01G320320 · TK1151

Plastid0.040

Rank 5 · TkA01G320320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14520HHH_58-50 aa

PF00730HhH-GPD11-78 aa

PF00633HHH28-47 aa

PF00154RecA_N62-140 aa

PF08423Rad5166-187 aa

PF13481AAA_2568-163 aa

PF05625PAXNEB73-93 aa

PF06745ATPase74-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G320320	`PF14520`	HHH_5	8	50	4.4e-07	31.0
TkA01G320320	`PF00730`	HhH-GPD	11	78	0.097	13.7
TkA01G320320	`PF00633`	HHH	28	47	0.15	12.7
TkA01G320320	`PF00154`	RecA_N	62	140	2.3e-06	28.0
TkA01G320320	`PF08423`	Rad51	66	187	3.4e-62	210.6
TkA01G320320	`PF13481`	AAA_25	68	163	7.6e-05	23.1
TkA01G320320	`PF05625`	PAXNEB	73	93	0.23	11.2
TkA01G320320	`PF06745`	ATPase	74	115	0.00039	20.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P94102`	Arabidopsis thaliana	sp\|P94102\|RAD51_ARATH DNA repair protein RAD51 homolog 1	89.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card