TkA01G319560 | RubberDandelionOmics

Gene overview

TkA01G319560

Reference: TK1151 Chr: Chr01 Coordinates: 79327156-79332470 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4498 bp · TkA01G319560|TK1151|cDNA

AAAGTGCTAGGGTTTCAGAAAAGCCTACCAACATATCTCTCTCTTTTCTCTCAAATTCATCAAATTCAAGACTTCGCTTTTCCGATCCAGACAAATTTCGAGGATAAACGATGCCTCCGAAATCGGCGAGGAAGTCAGTCGGGCCAGGGAGAAGAGGCGGAAGAACTAGAGGAACGCCGAAAGTGGCGGCGCAGCCTGATCCGGAGGCAGTAGCGGTACCTGAAGAATCAAAGAAGCCGGCCGAGGAGGTGCCAATTGAG...

CDS

Download CDS FASTA

2022 bp · TkA01G319560|TK1151|CDS

ATGGAAGAGGAACCGGAACCAGAACCAGAACCAGAGCCAGATCATCACGCTGACGTGGCAGACGAACAGGAACAGGAGCAAGAACACCACGATGTCTTCAAAGAGAGACGCAAACGAAAGGAGTTTGAAATCTTTGTAGGTGGACTAGACAAAGATGCAACCGAAGAGGATCTTAGGAAAGTGTTTAGTGCAGTTGGTGAGGTGGCAGAAGTCAGGCTTATGATGAATGCTCAAACAAAGAAGAACAAAGGATTTGCTTT...

Protein

Download Protein FASTA

673 aa · TkA01G319560|TK1151|PROTEIN

MEEEPEPEPEPEPDHHADVADEQEQEQEHHDVFKERRKRKEFEIFVGGLDKDATEEDLRKVFSAVGEVAEVRLMMNAQTKKNKGFAFLRFATVEQAKRACVELKSPVVHGKQCGVSPSQDSDTLFVGNVCKTWTKEALKEKLKKYGVDTVEDLTLVEDNKNDGTNRGFAFLEFSSRSDAMDAFKRLQKRDVNFGVDRPAKVSFADSFIDPGDEIMAQVKTVFIDGLPASWDEGRVRDLLKKYGEVVKIELARNMPSARRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G319560`
TK1151 ID	TkA01G319560
OH-1004 ID	LXL04_033558
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.600
Protein coverage (%)	TK1151 95.840 / OH-1004 67.899 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G319560`
Location	Chr01:79327156-79332470 (-)
Description	Similar to LIF2: Heterogeneous nuclear ribonucleoprotein Q
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033558` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006396 RNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0007623 circadian rhythm Biological Process GO:0008380 RNA splicing Biological Process GO:0009617 response to bacterium Biological Process GO:0009909 regulation of flower development Biological Process GO:0010439 regulation of glucosinolate biosynthetic process Biological Process GO:0010468 regulation of gene expression Biological Process GO:0016556 mRNA modification Biological Process GO:0017148 negative regulation of translation Biological Process
KEGG gene cross-reference	ath:AT4G00830 dre:562991 hsa:10492 mmu:56403 rno:363113 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · TkA01G319560 · TK1151

Cytoplasm0.080

Rank 2 · TkA01G319560 · TK1151

Cell membrane0.021

Rank 3 · TkA01G319560 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA01G319560 · TK1151

Plastid0.007

Rank 5 · TkA01G319560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05887Trypan_PARP2-28 aa

PF16367RRM_743-92 aa

PF00076RRM_144-112 aa

PF13893RRM_545-120 aa

PF08777RRM_346-105 aa

PF28441RRM_1148-101 aa

PF22976RRM_1051-101 aa

PF28976RRM_ACIN154-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G319560	`PF05887`	Trypan_PARP	2	28	6.2	7.5
TkA01G319560	`PF16367`	RRM_7	43	92	1.3e-09	38.6
TkA01G319560	`PF00076`	RRM_1	44	112	3.3e-43	146.1
TkA01G319560	`PF13893`	RRM_5	45	120	0.00079	19.8
TkA01G319560	`PF08777`	RRM_3	46	105	0.0021	18.8
TkA01G319560	`PF28441`	RRM_11	48	101	0.029	15.4
TkA01G319560	`PF22976`	RRM_10	51	101	5.2e-06	27.2
TkA01G319560	`PF28976`	RRM_ACIN1	54	104	0.014	16.1
TkA01G319560	`PF14605`	Nup35_RRM_2	62	99	0.34	11.5
TkA01G319560	`PF14703`	PHM7_cyt	72	119	0.011	16.7
TkA01G319560	`PF04059`	RRM_2	73	91	0.4	11.6
TkA01G319560	`PF11608`	RRM_MARF1	83	118	0.00027	21.8
TkA01G319560	`PF22976`	RRM_10	121	184	5.2e-06	27.2
TkA01G319560	`PF16367`	RRM_7	122	177	1.3e-09	38.6
TkA01G319560	`PF28976`	RRM_ACIN1	122	147	0.014	16.1
TkA01G319560	`PF04059`	RRM_2	123	186	0.4	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card