TkA01G319550 | RubberDandelionOmics

Gene overview

TkA01G319550

Reference: TK1151 Chr: Chr01 Coordinates: 79322620-79324664 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1968 bp · TkA01G319550|TK1151|cDNA

AAGATTTAAGGATTATTTGTGTAATCGACTCCTTTTTAAAAGAATATTTCATTAACGATGGTTCCTTTTTTGCTTCACATTTAAGGTAATATTTGATCTTCAAAAAACTCTAGTGGTAATAAACAAAAGTTTGTTGCGTTTGGCTTAAGAGATTTTTTTTCGACGGAATAGCGTTATTCCGCCACCCCTCATGGTCTGTCTCCGATAGTCCGATGGTAATATTTGATCTCGATAGACGATAAAGAGTAGAAAACGACCCG...

CDS

Download CDS FASTA

1065 bp · TkA01G319550|TK1151|CDS

ATGGCCAGCTCCAACTCACCTTCTTCCTCTCACGAACCAACAGATCCACTCGCCGCCCAACCGCCTACCTCTACGGCGGCTTCTCGCCGGGTACCTCTTCCCTGCTGGTCTCACGACGAGACTGTGGCGCTGATCGATGCGTATCGTGGTAAGTGGTACTCTCTCCAGCGAGGCAACCTCCGTGCCCCCCACTGGCAGGAAGTCGCCGATGGTGTCGCCGCTCAGTGCCCTTTAAGCAACCCACCGAAAACCTCGATTCA...

Protein

Download Protein FASTA

354 aa · TkA01G319550|TK1151|PROTEIN

MASSNSPSSSHEPTDPLAAQPPTSTAASRRVPLPCWSHDETVALIDAYRGKWYSLQRGNLRAPHWQEVADGVAAQCPLSNPPKTSIQCRHKMEKLRKRYRAEIQRIGNTPRGHRYPSSWVHFKQMDAMELGISSSDPSADPTNYEDDDEVDGGDEDNEEELFLYPKGIKQAIALPPNRRYQGSSGNAVAAGNGNRNGNGVRIKFPNTAAVPPPPLYKPNTSYDDYLPPMNPHYRSGKRSRDGFMKDAFGSGKSRTHHGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G319550`
TK1151 ID	TkA01G319550
OH-1004 ID	LXL04_033557
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 93.785 / OH-1004 77.934 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G319550

Location Chr01:79322620-79324664 (-)

Description Similar to ASIL2: Trihelix transcription factor ASIL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14180`	Transcription regulator that may repress the maturation program during early embryogenesis.	MicroRNAs regulate the timing of embryo maturation in Arabidopsis.2011 · DOI: 10.1104/pp.110.171355

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033557 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003682 chromatin binding Molecular Function

KEGG gene cross-reference

ath:AT1G54060

ath:AT3G11100

ath:AT3G14180

ath:AT4G17060

ath:AT5G05550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.983

Rank 1 · TkA01G319550 · TK1151

Cytoplasm0.055

Rank 2 · TkA01G319550 · TK1151

Cell membrane0.021

Rank 3 · TkA01G319550 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA01G319550 · TK1151

Plastid0.009

Rank 5 · TkA01G319550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_435-128 aa

PF10545MADF_DNA_bdg58-127 aa

PF10545MADF_DNA_bdg298-315 aa

PF13837Myb_DNA-bind_4327-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G319550	`PF13837`	Myb_DNA-bind_4	35	128	7.2e-17	62.3
TkA01G319550	`PF10545`	MADF_DNA_bdg	58	127	3.7e-09	37.5
TkA01G319550	`PF10545`	MADF_DNA_bdg	298	315	3.7e-09	37.5
TkA01G319550	`PF13837`	Myb_DNA-bind_4	327	335	7.2e-17	62.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJG8`	Arabidopsis thaliana	sp\|Q9LJG8\|ASIL2_ARATH Trihelix transcription factor ASIL2	39.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card