Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2582 bp · TkA01G319510|TK1151|cDNA
ATATAACTCCCTTTGTGAACACCTTCCACACCTTTTAGACTTTTATTCTAAGAAAATAAGTAGAATAGTCTGTGCTTTCGCGTAGTGGGCGCGCCCCCCGAAAAAAAGAAAAGGTTTAGTGAATTGGAATCGTGGGTTTACCCTTAACTTTAATGATATTCTTCACTCTTCAGTAGCGATTAAGGGTTTGTAAGAGCGTCGACACAGGATCTCTTCTGTCCGTCTGAACTCTCTTTATTTGAGCAGGTTCACAATGATAT...
351 bp · TkA01G319510|TK1151|CDS
ATGCCATTGGATGGTGCACTTGGATGCGAATCTGCTCCTGATAGTGCGATGGTGGCAGAACGTGTGGTAAAAAGCGAAGTTATGAATTTGTCGAGTGTGTCTCATATTCCAAAACAAAAGAAAAAGAAAAGCAAGGTTGAGATGCCGAATAGTATGGTAAAAATCACACCTGCAATGCTGCCGGATGATGTGGTAGAAAAGAAAGTTGTGAATTTGTCGAGGCGTACGTATAAGTGTCGGTTTGCAGATATATGTCAGGA...
Protein
Download Protein FASTA116 aa · TkA01G319510|TK1151|PROTEIN
MPLDGALGCESAPDSAMVAERVVKSEVMNLSSVSHIPKQKKKKSKVEMPNSMVKITPAMLPDDVVEKKVVNLSRRTYKCRFADICQEGEDFNAKSKPQTRRTESSQSYPTLRILLE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G319510 |
|---|---|
| TK1151 ID | TkA01G319510 |
| OH-1004 ID | LXL04_033553 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 81.034 / OH-1004 21.759Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G319510 |
|---|---|
| Location | Chr01:79307574-79313213 (-) |
| Description | Similar to PIX13: Probable serine/threonine-protein kinase PIX13 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002221 pattern recognition receptor signaling pathway Biological Process GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0010073 meristem maintenance Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0010088 phloem development Biological Process GO:0010492 maintenance of shoot apical meristem identity Biological Process GO:0031663 lipopolysaccharide-mediated signaling pathway Biological Process GO:0042742 defense response to bacterium Biological Process GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process GO:1900426 positive regulation of defense response to bacterium Biological Process |
| KEGG gene cross-reference | ath:AT1G14370 ath:AT2G02800 ath:AT2G17220 ath:AT5G02290 ath:AT5G15080 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07726AAA_344-83 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G319510 | PF07726 | AAA_3 | 44 | 83 | 0.11 | 13.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.