TkA01G319130 | RubberDandelionOmics

Gene overview

TkA01G319130

Reference: TK1151 Chr: Chr01 Coordinates: 79220109-79222865 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1220 bp · TkA01G319130|TK1151|cDNA

TGAACGGCTCCAAATTAACGACGTCGTTCGGTTTTCTTGACATTGCTCCATCAAAAAACTTCGTTCCTTTTCTCTTCCAAATCCATCTGCTCGCTTCCTCTGTTTACCGGCGTCGGCATCCATGGGCATCACGAAATCGGTTTCATCGCACCGGCTCACAAACTGAATCATCGGACGGAGATCTCACCCAGTTCGGCTTCTTTACGTTCGTTCGTGACTATATATCTTTCTATAGCCCCAAATCCCACTTCTGAAGAACA...

CDS

Download CDS FASTA

312 bp · TkA01G319130|TK1151|CDS

ATGCGGAGTATTGCAGGATTTAGAGTAATTCACGAAACACAAAAGGCGAAAGGCAAAATTACTGTCACAATCGCCAGTTTCATAGAAGGTGAATCTTTAGTTGAAAGCTGTATACCTCAAACTGAATTGGTTCCAACAACATTAGTTCTGAATGATATTGCAACAAGATTCATAGCTTGTGAGATTGATTTCATGAACACACCTGTCTCAAAAGCGATGACAAAGAATTCAATCTATGTCCTATCTGATACTCTTGCGGT...

Protein

Download Protein FASTA

103 aa · TkA01G319130|TK1151|PROTEIN

MRSIAGFRVIHETQKAKGKITVTIASFIEGESLVESCIPQTELVPTTLVLNDIATRFIACEIDFMNTPVSKAMTKNSIYVLSDTLAVEALQKMVQGKLDTCQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G319130`
TK1151 ID	TkA01G319130
OH-1004 ID	LXL04_019949
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 93.204 / OH-1004 31.270 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G319130

Location Chr01:79220109-79222865 (+)

Description Similar to VPS35B: Vacuolar protein sorting-associated protein 35B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63490`	CBS domain-containing protein CBSCBSPB1.	No verified direct reference in this release
`At5g50530`	CBS domain-containing protein CBSCBSPB4.	No verified direct reference in this release
`At5g50640`	CBS domain-containing protein CBSCBSPB5.	No verified direct reference in this release
`At2g36500`	CBS domain-containing protein CBSCBSPB2.	No verified direct reference in this release
`At3g52950`	CBS domain-containing protein CBSCBSPB3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019949 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0030904 retromer complex Cellular Component

GO:0030906 retromer, cargo-selective complex Cellular Component

KEGG gene cross-reference

ath:AT1G75850

ath:AT3G51310

ath:AT5G50530

ath:AT5G50640

ath:AT5G63490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.390

Rank 1 · TkA01G319130 · TK1151

Nucleus0.255

Rank 2 · TkA01G319130 · TK1151

Endoplasmic reticulum0.153

Rank 3 · TkA01G319130 · TK1151

Cell membrane0.128

Rank 4 · TkA01G319130 · TK1151

Mitochondrion0.126

Rank 5 · TkA01G319130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17607DUF550332-72 aa

PF00571CBS69-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G319130	`PF17607`	DUF5503	32	72	0.17	12.9
TkA01G319130	`PF00571`	CBS	69	95	0.097	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMV3`	Arabidopsis thaliana	sp\|Q9FMV3\|Y5349_ARATH CBS domain-containing protein CBSCBSPB1	62.500%	Swiss-Prot	Medium
`Q0WLC7`	Arabidopsis thaliana	sp\|Q0WLC7\|Y5053_ARATH CBS domain-containing protein CBSCBSPB4	69.600%	Swiss-Prot	Low
`P0DH79`	Arabidopsis thaliana	sp\|P0DH79\|Y5064_ARATH CBS domain-containing protein CBSCBSPB5	69.600%	Swiss-Prot	Low
`Q9SJQ5`	Arabidopsis thaliana	sp\|Q9SJQ5\|Y2650_ARATH CBS domain-containing protein CBSCBSPB2	65.200%	Swiss-Prot	Low
`Q9LF97`	Arabidopsis thaliana	sp\|Q9LF97\|Y3295_ARATH CBS domain-containing protein CBSCBSPB3	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card