TkA01G317960 | RubberDandelionOmics

Gene overview

TkA01G317960

Reference: TK1151 Chr: Chr01 Coordinates: 78934417-78935975 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

647 bp · TkA01G317960|TK1151|cDNA

AAGAAATGCGATTTGATCCGCTCTAAACAAAAGGCAAATGGAAGATGTGAAAAATGTCAAAAGAAGCCCCGAAAATCCTTGTTCAAAGAACAACAATAACAACAACAATAATAACAAAGAACAAGACCGGTTCCTCCAATAGCCAATGTGGGTCGAATAATGAAAAAAGTCATCCCTGGAACGGAAAAATATCAAAAGATGCAAAAGAGACGGTCCAAGAATGTGTCTCGGAGTTTATCAGCTTTGTCACAGGTGAAGCC...

CDS

Download CDS FASTA

495 bp · TkA01G317960|TK1151|CDS

ATGTCAAAAGAAGCCCCGAAAATCCTTGTTCAAAGAACAACAATAACAACAACAATAATAACAAAGAACAAGACCGGTTCCTCCAATAGCCAATGTGGGTCGAATAATGAAAAAAGTCATCCCTGGAACGGAAAAATATCAAAAGATGCAAAAGAGACGGTCCAAGAATGTGTCTCGGAGTTTATCAGCTTTGTCACAGGTGAAGCCTCAGATAAATGCCAACGAGAAAAGAGAAAAACGATAAATGGTGATGATATAAC...

Protein

Download Protein FASTA

164 aa · TkA01G317960|TK1151|PROTEIN

MSKEAPKILVQRTTITTTIITKNKTGSSNSQCGSNNEKSHPWNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDITWAITTLGFEEYVEPLKLYLTKYRQQEDKGNTNLAKPQQCIEQQQQSLQASYKSLYSSTTTNIMSQQPFATFEMMEKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G317960`
TK1151 ID	TkA01G317960
OH-1004 ID	LXL04_033537
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 71.341 / OH-1004 60.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G317960

Location Chr01:78934417-78935975 (+)

Description Similar to NFYB7: Nuclear transcription factor Y subunit B-7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14540`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release
`At2g13570`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release
`At5g47640`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0573500`	Component of the NF-Y/HAP transcription factor complex.	OsHAP3 genes regulate chloroplast biogenesis in rice.2003 · DOI: 10.1046/j.1365-313x.2003.01897.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033537 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT2G13570

ath:AT4G14540

ath:AT5G47640

osa:9268669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.909

Rank 1 · TkA01G317960 · TK1151

Cytoplasm0.220

Rank 2 · TkA01G317960 · TK1151

Mitochondrion0.026

Rank 3 · TkA01G317960 · TK1151

Cell membrane0.017

Rank 4 · TkA01G317960 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA01G317960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00808CBFD_NFYB_HMF1-11 aa

PF25066TPR_VPS8_29-72 aa

PF28395RglB_N35-57 aa

PF00808CBFD_NFYB_HMF38-90 aa

PF00125Histone45-90 aa

PF28395RglB_N77-115 aa

PF25066TPR_VPS8_2111-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G317960	`PF00808`	CBFD_NFYB_HMF	1	11	2.2e-19	70.2
TkA01G317960	`PF25066`	TPR_VPS8_2	9	72	0.53	10.4
TkA01G317960	`PF28395`	RglB_N	35	57	0.11	13.4
TkA01G317960	`PF00808`	CBFD_NFYB_HMF	38	90	2.2e-19	70.2
TkA01G317960	`PF00125`	Histone	45	90	0.00043	21.3
TkA01G317960	`PF28395`	RglB_N	77	115	0.11	13.4
TkA01G317960	`PF25066`	TPR_VPS8_2	111	151	0.53	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23310`	Arabidopsis thaliana	sp\|O23310\|NFYB3_ARATH Nuclear transcription factor Y subunit B-3	79.000%	Swiss-Prot	Low
`Q9SIT9`	Arabidopsis thaliana	sp\|Q9SIT9\|NFYB7_ARATH Nuclear transcription factor Y subunit B-7	89.000%	Swiss-Prot	Low
`Q9FGJ3`	Arabidopsis thaliana	sp\|Q9FGJ3\|NFYB2_ARATH Nuclear transcription factor Y subunit B-2	73.600%	Swiss-Prot	Medium
`Q60EQ4`	Oryza sativa subsp. japonica	sp\|Q60EQ4\|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3	78.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card